KEGG   Thermotoga maritima MSB8: TM1192Help
Entry
TM1192            CDS       T00022                                 

Definition
(RefSeq) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma00052  Galactose metabolism
tma00561  Glycerolipid metabolism
tma00600  Sphingolipid metabolism
tma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TM1192
  Lipid metabolism
   00561 Glycerolipid metabolism
    TM1192
   00600 Sphingolipid metabolism
    TM1192
Enzymes [BR:tma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     TM1192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_31
Motif
Other DBs
NCBI-GeneID: 898292
NCBI-ProteinID: NP_228997
UniProt: G4FEF4
Structure
PDB: 

Position
complement(1209118..1210776)
Genome map
AA seq 552 aa AA seqDB search
MEIFGKTFREGRFVLKEKNFTVEFAVEKIHLGWKISGRVKGSPGRLEVLRTKAPEKVLVN
NWQSWGPCRVVDAFSFKPPEIDPNWRYTASVVPDVLERNLQSDYFVAEEGKVYGFLSSKI
AHPFFAVEDGELVAYLEYFDVEFDDFVPLEPLVVLEDPNTPLLLEKYAELVGMENNARVP
KHTPTGWCSWYHYFLDLTWEETLKNLKLAKNFPFEVFQIDDAYEKDIGDWLVTRGDFPSV
EEMAKVIAENGFIPGIWTAPFSVSETSDVFNEHPDWVVKENGEPKMAYRNWNKKIYALDL
SKDEVLNWLFDLFSSLRKMGYRYFKIDFLFAGAVPGERKKNITPIQAFRKGIETIRKAVG
EDSFILGCGSPLLPAVGCVDGMRIGPDTAPFWGEHIEDNGAPAARWALRNAITRYFMHDR
FWLNDPDCLILREEKTDLTQKEKELYSYTCGVLDNMIIESDDLSLVRDHGKKVLKETLEL
LGGRPRVQNIMSEDLRYEIVSSGTLSGNVKIVVDLNSREYHLEKEGKSSLKKRVVKREDG
RNFYFYEEGERE
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
gtggaaatattcggaaagaccttcagagagggaagattcgttctcaaagagaaaaacttc
acagttgagttcgcggtggagaagatacaccttggctggaagatctccggcagggtgaag
ggaagtccgggaaggcttgaggttcttcgaacgaaagcaccggaaaaggtacttgtgaac
aactggcagtcctggggaccgtgcagggtggtcgatgccttttctttcaaaccacctgaa
atagatccgaactggagatacaccgcttcggtggtgcccgatgtacttgaaaggaacctc
cagagcgactatttcgtggctgaagaaggaaaagtgtacggttttctgagttcgaaaatc
gcacatcctttcttcgctgtggaagatggggaacttgtggcatacctcgaatatttcgat
gtcgagttcgacgactttgttcctcttgaacctctcgttgtactcgaggatcccaacaca
ccccttcttctggagaaatacgcggaactcgtcggaatggaaaacaacgcgagagttcca
aaacacacacccactggatggtgcagctggtaccattacttccttgatctcacctgggaa
gagaccctcaagaacctgaagctcgcgaagaatttcccgttcgaggtcttccagatagac
gacgcctacgaaaaggacataggtgactggctcgtgacaagaggagactttccatcggtg
gaagagatggcaaaagttatagcggaaaacggtttcatcccgggcatatggaccgccccg
ttcagtgtttctgaaacctcggatgtattcaacgaacatccggactgggtagtgaaggaa
aacggagagccgaagatggcttacagaaactggaacaaaaagatatacgccctcgatctt
tcgaaagatgaggttctgaactggcttttcgatctcttctcatctctgagaaagatgggc
tacaggtacttcaagatcgactttctcttcgcgggtgccgttccaggagaaagaaaaaag
aacataacaccaattcaggcgttcagaaaagggattgagacgatcagaaaagcggtggga
gaagattctttcatcctcggatgcggctctccccttcttcccgcagtgggatgcgtcgac
gggatgaggataggacctgacactgcgccgttctggggagaacatatagaagacaacgga
gctcccgctgcaagatgggcgctgagaaacgccataacgaggtacttcatgcacgacagg
ttctggctgaacgaccccgactgtctgatactgagagaggagaaaacggatctcacacag
aaggaaaaggagctctactcgtacacgtgtggagtgctcgacaacatgatcatagaaagc
gatgatctctcgctcgtcagagatcatggaaaaaaggttctgaaagaaacgctcgaactc
ctcggtggaagaccacgggttcaaaacatcatgtcggaggatctgagatacgagatcgtc
tcgtctggcactctctcaggaaacgtcaagatcgtggtcgatctgaacagcagagagtac
cacctggaaaaagaaggaaagtcctccctgaaaaaaagagtcgtcaaaagagaagacgga
agaaacttctacttctacgaagagggtgagagagaatga

DBGET integrated database retrieval system