KEGG   Thermotoga maritima MSB8: TM1276
Entry
TM1276            CDS       T00022                                 
Name
(GenBank) sugar ABC transporter, ATP-binding protein
  KO
K10112  multiple sugar transport system ATP-binding protein [EC:7.5.2.-]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:tma00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    TM1276
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tma02000]
    TM1276
Transporters [BR:tma02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter
    TM1276
   Maltose transporter
    TM1276
   Arabinogalactan oligomer/maltooligosaccharide transport system
    TM1276
   Raffinose/stachyose/melibiose transporter
    TM1276
   Alpha-glucoside transporter
    TM1276
   Glucose/mannose transporter
    TM1276
   Trehalose/maltose transporter
    TM1276
   Cellobiose transporter
    TM1276
   N,N'-Diacetylchitobiose transporter
    TM1276
   L-Arabinose/D-xylose transporter
    TM1276
   Fructooligosaccharide transporter
    TM1276
   Putative sorbitol/mannitol transporter
    TM1276
   Arabinooligosaccharide transporter
    TM1276
   Polygalacturonan/rhamnogalacturonan transporter
    TM1276
   Pectin-derived oligosaccharide transporter
    TM1276
   Putative multiple sugar transporter
    TM1276
SSDB
Motif
Pfam: ABC_tran OB_MalK TOBE TOBE_2 AAA_21 SMC_N Rad17 CysA_C_terminal AAA_22 AAA_16 AAA RsgA_GTPase ATPase_2 AAA_30 RuvB_N IstB_IS21 AAA_28 PhoH AAA_18 AAA_19 AAA_14 AAA_5 S4 AAA_23 NACHT AAA_24
Other DBs
NCBI-ProteinID: AAD36351
UniProt: Q9X103
Position
1301313..1302422
AA seq 369 aa
MRMAQVVLENVTKVYENKVVAVKNANLVVEDKEFVVLLGPSGCGKTTTLRMIAGLEEITD
GKIYIDGKVVNDVEPKDRDIAMVFQNYALYPHMTVYENMAFGLKLRKYPKDEIDRRVREA
AKILGIENLLDRKPRQLSGGQRQRVAVGRAIVRNPKVFLFDEPLSNLDAKLRVQMRSELK
KLHHRLQATIIYVTHDQVEAMTMADKIVVMKDGEIQQIGTPHEIYNSPANVFVAGFIGSP
PMNFVNARVVRGEGGLWIQASGFKVKVPKEFEDKLANYIDKEIIFGIRPEDIYDKLFALA
PSPENTITGVVDVVEPLGSETILHVKVGDDLIVASVNPRTQAKEEQKIDLVLDMTRMHAF
DKETEKAII
NT seq 1110 nt   +upstreamnt  +downstreamnt
gtgagaatggctcaggttgtccttgaaaacgtcaccaaggtctacgaaaacaaagtcgtc
gctgtgaaaaacgcgaatctcgtcgtcgaagacaaggagttcgtggttctccttggacca
tccggctgtggaaagacgaccactctgaggatgatcgcaggactggaggagatcacagat
ggaaagatctacatcgacggcaaggttgtgaacgacgtcgaaccaaaagacagagacatc
gccatggtgttccagaactacgctctgtatccacacatgaccgtctacgaaaacatggcc
ttcggtttgaaactgagaaaatatccaaaggacgaaatcgacagaagagtacgtgaagct
gcgaaaatcctcggaatagaaaacctgctcgacagaaaaccgagacagctttcaggtggt
cagaggcagagggtcgccgttggaagagccatcgtgagaaatccgaaggtcttcctcttc
gacgaaccactctccaacctcgacgcgaaactcagagtgcagatgagaagcgagctcaag
aagctccaccacagactccaggcaacgatcatctacgtgacacacgaccaggtggaagcg
atgacaatggctgacaagatcgttgtcatgaaggacggagaaatccagcagataggaact
ccacacgaaatatacaactctccagcgaacgtcttcgtcgccggattcatcggtagccct
ccaatgaatttcgtcaacgcgagagtcgtgagaggagaaggtggcctctggatccaggca
tctggcttcaaagtgaaggtgcctaaggaatttgaagacaagctcgcaaactacatcgac
aaggagatcatcttcggtatcagacctgaagatatatacgacaagctcttcgcactggca
ccttcaccagagaacacgatcacaggtgttgtggatgtggtcgaacccctcggaagtgaa
acgattctccacgtgaaagtcggagacgacttgattgtggcatccgtcaacccgaggact
caggcaaaagaagaacagaaaatcgatctggtactcgacatgacgagaatgcacgccttc
gataaagaaacggagaaggctattatctga

DBGET integrated database retrieval system