KEGG   Thermotoga maritima MSB8: TM1281Help
Entry
TM1281            CDS       T00022                                 

Definition
(RefSeq) 6-phospho-beta-glucosidase BglT
  KO
K01222  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma00010  Glycolysis / Gluconeogenesis
tma00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:tma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TM1281
   00500 Starch and sucrose metabolism
    TM1281
Enzymes [BR:tma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     TM1281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4C Glyco_hydro_4
Motif
Other DBs
NCBI-GeneID: 898202
NCBI-ProteinID: NP_229086
UniProt: Q9X108 G4FE67
Structure
PDB: 

Position
1308085..1309332
Genome map
AA seq 415 aa AA seqDB search
MRIAVIGGGSSYTPELVKGLLDISEDVRIDEVIFYDIDEEKQKIVVDFVKRLVKDRFKVL
ISDTFEGAVVDAKYVIFQFRPGGLKGRENDEGIPLKYGLIGQETTGVGGFSAALRAFPIV
EEYVDTVRKTSNATIVNFTNPSGHITEFVRNYLEYEKFIGLCNVPINFIREIAEMFSARL
EDVFLKYYGLNHLSFIEKVFVKGEDVTEKVFENLKLKLSNIPDEDFPTWFYDSVRLIVNP
YLRYYLMEKKMFKKISTHELRAREVMKIEKELFEKYRTAVEIPEELTKRGGSMYSTAAAH
LIRDLETDEGKIHIVNTRNNGSIENLPDDYVLEIPCYVRSGRVHTLSQGKGDHFALSFIH
AVKMYERLTIEAYLKRSKKLALKALLSHPLGPDVEDAKDLLEEILEANREYVKLG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgagaattgcggtgataggtgggggaagcagctacaccccggagctggtgaagggactt
ctcgacatttccgaggatgttcgcatcgacgaggtgatcttctacgacatcgacgaagaa
aagcagaaaatcgtcgttgatttcgtgaagagactcgtcaaagacaggttcaaggtgctc
ataagcgacaccttcgagggtgctgtcgtggacgcgaagtacgtgatctttcagttcaga
cccggcggactcaaaggtagagaaaacgacgaaggcattccgctgaagtacggtctcata
ggtcaagagacaacgggggttgggggattttcagcggctttgagggcgtttcccatagta
gaagagtacgttgataccgtgagaaaaacatcgaacgcgaccatcgtaaacttcaccaac
ccatccggccacattacggagttcgtgagaaactacctcgaatacgaaaaattcataggt
ctctgcaacgttcccataaacttcatccgggagatcgcagagatgttctcagcaaggctc
gaagacgtgttcctgaagtactacggcctcaaccatctgagcttcatagagaaggtcttc
gtaaaaggtgaagacgtgacggaaaaggttttcgagaacctgaagctgaagctctccaac
ataccagacgaggatttcccgacgtggttctacgactcggtgagactcattgtgaatcct
tacctgaggtactacctgatggagaagaagatgttcaaaaagatctccacacacgagctc
agagcaagggaagtgatgaagatagagaaagaactcttcgagaagtacagaaccgctgtc
gagataccggaggaactcacaaaacgcggtggcagcatgtattccacagcggcagctcac
ctgataagagacctcgaaaccgacgaaggaaagatacacatcgtgaacacgagaaacaac
ggctcgatcgagaacctcccggatgattacgttctggagatcccgtgttatgtgagatcc
ggcagggttcacacgctctcgcagggaaaaggagatcactttgctctttctttcatccac
gcggtgaagatgtacgagcgactcacaatagaagcgtatctgaagagatcgaaaaaactc
gctctaaaggctttgctttcccatcctctcggacccgatgtggaggacgcaaaagacctt
ctcgaagagatactggaggcgaacagagaatacgtgaaactggggtga

DBGET integrated database retrieval system