KEGG   Thermotoga maritima MSB8: TM1414Help
Entry
TM1414            CDS       T00022                                 

Definition
(RefSeq) beta-fructosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma00052  Galactose metabolism
tma00500  Starch and sucrose metabolism
tma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    TM1414
   00500 Starch and sucrose metabolism
    TM1414
Enzymes [BR:tma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     TM1414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-GeneID: 898062
NCBI-ProteinID: NP_229215
UniProt: O33833 G4FFE9
Structure
PDB: 

Position
complement(1428814..1430112)
Genome map
AA seq 432 aa AA seqDB search
MFKPNYHFFPITGWMNDPNGLIFWKGKYHMFYQYNPRKPEWGNICWGHAVSDDLVHWRHL
PVALYPDDETHGVFSGSAVEKDGKMFLVYTYYRDPTHNKGEKETQCVAMSENGLDFVKYD
GNPVISKPPEEGTHAFRDPKVNRSNGEWRMVLGSGKDEKIGRVLLYTSDDLFHWKYEGVI
FEDETTKEIECPDLVRIGEKDILIYSITSTNSVLFSMGELKEGKLNVEKRGLLDHGTDFY
AAQTFFGTDRVVVIGWLQSWLRTGLYPTKREGWNGVMSLPRELYVENNELKVKPVDELLA
LRKRKVFETAKSGTFLLDVKENSYEIVCEFSGEIELRMGNESEEVVITKSRDELIVDTTR
SGVSGGEVRKSTVEDEATNRIRAFLDSCSVEFFFNDSIAFSFRIHPENVYNILSVKSNQV
KLEVFELENIWL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagccgaattatcactttttcccgataacaggctggatgaacgatccgaacggt
ttgatcttctggaagggaaaatatcatatgttctatcagtataatcccagaaaacctgag
tggggaaacatctgctggggccacgcggtgagcgacgatctcgttcactggagacacctt
cccgttgctctatatcccgacgatgaaacacacggagtgttctctggaagcgctgtcgag
aaagatgggaaaatgtttctcgtgtacacctactaccgcgatccgacacacaacaaagga
gaaaaagaaacccagtgtgtggctatgagtgaaaacggattggatttcgtaaagtacgat
ggaaacccggtcatatctaaacccccagaggaagggacgcacgccttcagagacccgaag
gtgaacagaagcaacggtgagtggcgaatggtactgggatctggtaaagatgagaagatt
ggaagagtgcttctctatacctcagatgacctttttcactggaagtacgagggtgtgatc
ttcgaagatgaaaccacaaaagaaatagagtgtcccgatcttgtgagaattggagagaaa
gatatcctcatatactcgataacgagtacaaacagcgttctgttttccatgggagagtta
aaggaaggaaaactgaatgtcgaaaagcgggggcttctcgatcacggaacggatttctac
gctgctcaaactttctttggaacagacagagttgtagttatcggatggcttcaaagctgg
ttgagaacagggctttacccgacaaaacgagaaggatggaacggtgtcatgagtcttcct
agggagctgtatgtagaaaacaacgagttgaaggtgaaaccggtggatgaactcttggct
ctcagaaagagaaaggttttcgaaactgcaaagtccggaacatttctgctggatgtcaag
gaaaacagttatgaaattgtgtgtgaattcagcggagaaatcgaacttcgaatgggaaat
gaatctgaagaagtggtgataacgaagagtcgagacgaattaatcgtggatacaacgaga
tctggtgtttcaggtggagaagttagaaagtcgacagtcgaagatgaagctacaaataga
atacgagctttcttggattcgtgttctgtagaatttttcttcaacgactccatagctttt
tcctttaggatccatccagagaacgtttacaacattctttctgtcaaatcgaaccaagtg
aaactcgaagtctttgaactcgagaacatatggttgtga

DBGET integrated database retrieval system