KEGG   Thermotoga maritima MSB8: TM1461
Entry
TM1461            CDS       T00022                                 

Definition
(GenBank) inner membrane protein, putative
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
tma  Thermotoga maritima MSB8
Pathway
tma02024  Quorum sensing
tma03060  Protein export
tma03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:tma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    TM1461
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    TM1461
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    TM1461
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tma03029]
    TM1461
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tma02044]
    TM1461
Mitochondrial biogenesis [BR:tma03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    TM1461
Secretion system [BR:tma02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   TM1461
SSDB
Motif
Pfam: 60KD_IMP
Other DBs
NCBI-ProteinID: AAD36529
UniProt: Q9X1H2
Structure
PDB: 
5Y82 5Y83

Position
complement(1474340..1475677)
AA seq 445 aa
MVLRKVVAILLAILPIFLFAVEPIKVVRSEKEIVVLTRFEEYHFDLEKGILKDFYTLVDG
RKHVFTYGNDGFDVLDEGTPLTVIEEPIVTGVGKVSEGFSDEVSIVYNYGYVKKIFTIKN
NENYTFFVDIESSKPVDVTVPRVSVDTSTDRYLENYFASFNPKTRTLVLLKHDEGLLFEG
TLKVNGQKRFIVFMGPNKRTLIKKAFPEDYDVLIKALVNIPGFNKWYDSVFYGLVWFFWW
LKDLTKNFGWAIMLFTLIVRLILYPLYHAQTKSLINMRKLQPQIEAIKKKYKDPTKQQEA
LLKLYREAGVNPASGCLMLLIQLPIFMLLWSVIRYYVEEFAYSGSFLIWKDLSAGGFSNN
WLFLVITIVASYYTTLLTSQDARTAWQGIIMSVIFPFLFVGLPSGLFLYYATNTLIQLAV
TYYTYKRYKIKGLTTRELLGLPKKA
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggtcttgagaaaagttgtagcaatactgctcgccatacttccaatctttttgtttgct
gtggaaccgatcaaggttgttcgctccgaaaaggaaatagttgttctcaccaggtttgag
gagtatcacttcgatctggaaaagggcatactcaaagacttttacacccttgtcgatgga
agaaagcacgttttcacctatggaaacgatggcttcgatgtactcgatgagggaacacct
ttgacggtgatagaagaaccgatagtaactggtgtaggaaaagtatccgaaggtttctcc
gacgaggtaagtatcgtatacaactacggctacgtgaaaaagattttcacgataaagaac
aacgagaattacaccttctttgttgatatagaaagctcaaaacccgttgatgtgacggta
cccagagtatctgtcgatacctccacggatagatacctggaaaattactttgcatccttc
aatcccaaaacgcgtacgcttgtacttttaaagcatgacgaaggtctcctctttgaaggt
actctgaaggtaaacggacaaaaacgtttcatcgttttcatgggaccgaacaagagaact
ctcataaagaaagcctttccagaggattacgatgttctcataaaggcccttgtgaacata
ccaggattcaacaagtggtacgattctgtgttttacggtctggtctggttcttctggtgg
ctgaaagatctcacaaagaatttcggatgggcgatcatgctgttcacactgattgtgaga
ttgatactctatcctctctaccacgctcaaacgaaatctctcataaacatgaggaagtta
cagccgcagatagaagccattaagaagaagtacaaagacccgacgaaacagcaggaagcc
ctcctgaaactctacagagaagcgggagtgaatccagctagcggctgtctcatgctcctc
atacagctgcctatcttcatgcttctgtggtcggtcattagatactacgtcgaagaattt
gcctacagcggaagttttcttatctggaaagatctctccgcgggtggtttttccaacaac
tggctgtttctggtaatcaccatagtggcgagttactacacaacgcttctcacaagccag
gacgcgagaacagcctggcagggtatcatcatgtcggtgatcttcccgttcctgtttgtg
ggacttccaagcggactgttcctgtactatgcgactaacactctgattcagctcgcggtg
acttactatacctacaaacgctacaagataaaaggtctcacaacgagagaacttcttggt
cttccgaaaaaggcatga

DBGET integrated database retrieval system