KEGG   Thermotoga maritima MSB8: TM1480
Entry
TM1480            CDS       T00022                                 

Definition
(GenBank) preprotein translocase SecY subunit
  KO
K03076  preprotein translocase subunit SecY
Organism
tma  Thermotoga maritima MSB8
Pathway
tma02024  Quorum sensing
tma03060  Protein export
tma03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:tma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    TM1480
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    TM1480
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    TM1480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tma02044]
    TM1480
Secretion system [BR:tma02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   TM1480
SSDB
Motif
Pfam: SecY DUF4231
Other DBs
NCBI-ProteinID: AAD36546
UniProt: Q9X1I9
Structure
PDB: 
3DIN

Position
complement(1488279..1489574)
AA seq 431 aa
MWQAFKNAFKIPELRDRIIFTFLALIVFRMGIYIPVPGLNLEAWGEIFRRIAETAGVAGI
LSFYDVFTGGALSRFSVFTMSVTPYITASIILQLLASVMPSLKEMLREGEEGRKKFAKYT
RRLTLLIGGFQAFFVSFSLARSNPDMVAPGVNVLQFTVLSTMSMLAGTMFLLWLGERITE
KGIGNGISILIFAGIVARYPSYIRQAYLGGLNLLEWIFLIAVALITIFGIILVQQAERRI
TIQYARRVTGRRVYGGASTYLPIKVNQGGVIPIIFASAIVSIPSAIASITNNETLKNLFR
AGGFLYLLIYGLLVFFFTYFYSVVIFDPREISENIRKYGGYIPGLRPGRSTEQYLHRVLN
RVTFIGAVFLVVIALLPYLVQGAIKVNVWIGGTSALIAVGVALDIIQQMETHMVMRHYEG
FIKKGKIRGRR
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgtggcaagctttcaaaaacgcttttaaaataccagagcttcgcgacagaatcatcttc
acgttcctcgctttgatcgttttcaggatggggatttacatccccgttcctgggttgaat
ctggaagcgtggggggaaatcttcagaagaatagcggaaactgccggtgtcgctggaatt
ttgagtttctacgatgtgttcactggaggcgctctcagtcgattctccgtttttaccatg
agtgtcactccctacataaccgcatcgatcatccttcaactcctggcatccgttatgcct
tcgctcaaggagatgctcagagagggtgaagagggaagaaagaagtttgcgaagtacaca
agacgtctcacacttttgataggtggttttcaggctttctttgtttccttttcccttgca
agatcgaatccagacatggtagctcccggtgttaatgtgcttcagttcactgttctctcc
accatgtccatgcttgctggaactatgtttctgctctggctcggtgaaaggatcacagaa
aagggtataggaaacggtatctcgatcctgatcttcgcaggaatagtggcaaggtaccca
agctacatcagacaggcgtatctcggcggtctgaatctcctggaatggatctttctcata
gctgttgctctcatcacgatattcgggattatactcgttcagcaggcagagagaaggatc
accatacagtacgcaagaagggtcacgggaaggagagtgtatgggggagccagcacgtat
cttcctataaaggtgaaccagggtggtgtgattcccatcatctttgcgagtgccatagtt
tcaataccctctgcaatcgcttcaataacaaacaacgagactcttaaaaatctcttcaga
gcaggtggattcctctaccttctcatctatggattgctggttttcttcttcacttacttc
tacagcgtcgtgatattcgatcccagagagatctctgagaacatccgaaagtatggaggc
tacattcctggcttgagacctggaagatcaacggagcagtacctccacagagttctgaac
agagtgacgtttattggagcggtcttcctcgtagtcatagcacttcttccctacctggtc
cagggagccataaaggtgaacgtttggatcggaggaacttccgctctgatcgctgtggga
gttgctcttgacatcatccagcaaatggaaacccacatggtgatgagacactacgaagga
ttcatcaaaaagggtaaaataagggggagaagatga

DBGET integrated database retrieval system