KEGG   Thermotoga maritima MSB8: TM1509Help
Entry
TM1509            CDS       T00022                                 

Definition
(RefSeq) hypothetical protein
  KO
K07042  probable rRNA maturation factor
Organism
tma  Thermotoga maritima MSB8
Brite
KEGG Orthology (KO) [BR:tma00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:tma03009]
    TM1509
Ribosome biogenesis [BR:tma03009]
 Prokaryotic Type
  Other maturation factors
   TM1509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0054
Motif
Other DBs
NCBI-GeneID: 898186
NCBI-ProteinID: NP_229309
UniProt: Q9X1J7 G4FFP6
Structure
PDB: 

Position
1505927..1506379
Genome map
AA seq 150 aa AA seqDB search
MIRILGEGKGSKLLENLKEKLEEIVKKEIGDVHVNVILVSEDEIKELNQQFRGQDRPTDV
LTFPLMEEDVYGEIYVCPLIVEENAREFNNTFEKELLEVVIHGILHLAGYDHEFEDKNSK
EMFEKQKKYVEEVWGEWRSNPSEDSDPGKR
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgataagaatactgggtgaaggtaaaggatcgaaacttctcgaaaatttgaaagaaaaa
ctcgaagaaatcgtaaagaaagagataggagacgtacatgtaaacgtgattcttgtgagc
gaagatgaaattaaggaactcaaccagcagtttcggggtcaagatcgaccgacagacgtg
ctcacttttcccctcatggaagaagacgtctatggagaaatttacgtttgtcctctgatc
gtagaagaaaatgcgagagagttcaacaacaccttcgaaaaagaactgctggaagtggtg
atccacgggatacttcaccttgcaggatacgatcacgagttcgaagacaaaaactccaaa
gagatgttcgaaaaacagaaaaaatacgttgaggaggtatggggtgaatggagatcaaac
ccttcagaggattcagacccagggaagagatag

DBGET integrated database retrieval system