KEGG   Thermotoga maritima MSB8: TM1572
Entry
TM1572            CDS       T00022                                 

Definition
(GenBank) signal peptidase I, putative
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma03060  Protein export
Brite
KEGG Orthology (KO) [BR:tma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    TM1572
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tma01002]
    TM1572
Enzymes [BR:tma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     TM1572
Peptidases and inhibitors [BR:tma01002]
 Serine peptidases
  Family S26: signal peptidase I family
   TM1572
SSDB
Motif
Pfam: Peptidase_S26
Other DBs
NCBI-ProteinID: AAD36639
UniProt: Q9X1Q8
Position
1558976..1559896
AA seq 306 aa
MNLKKESVEWIKALLYALVAATIVRLYIFETMLVPTGSMIPTIQIGDRLFVEKITYTVRE
PQIGEIVVFWSPFVDERASHMLRLFDKFMDLFSPSKFRGHVKYVKRLVGKGGDVLEIKDG
KLYVNGEVPEVLKDRYYEPEGIFKYEDFYEWLYTASKLRKDKQAYRDFIYDIAKNYGRTA
AVLVFSLIGEEGLSYGEAFLPGLLNYFDPSMVYYDEKTKSYYIPGMIYHEFYEEYYSKLD
LKKYVGKTDDGTIRIRVPEGFYFLMGDNTKESLDCRYFGFVPKDHIIGWPILRIWPFERF
GPIQKY
NT seq 921 nt   +upstreamnt  +downstreamnt
atgaacttgaaaaaagaatccgtggaatggatcaaggcactcctttatgcactggttgca
gcgacgatcgtgagactctacatattcgagaccatgctggttccgactggatcgatgatc
ccaacgatacagattggggatcggctcttcgtcgaaaagatcacgtacactgtacgtgaa
ccgcagataggagaaatcgtggttttctggtcaccgttcgtggatgagagagcaagccac
atgctccgacttttcgataaattcatggatctcttttctcccagtaagttcaggggtcat
gtaaagtacgtgaagcgcctcgttggaaagggtggagatgtcctcgaaataaaggacgga
aaactctacgtgaacggtgaggttccggaagttttgaaagacaggtactacgagccggaa
gggattttcaaatacgaagatttttacgaatggctgtacacagcgagcaagctgagaaaa
gacaaacaagcgtacagagatttcatatacgatatcgcaaagaattatggcagaacagcg
gcagttcttgttttctccctcatcggggaggaaggtctcagctacggagaagctttcctc
cccggtttgttgaactatttcgatccatccatggtttactacgacgagaaaacgaaatcc
tattacatcccaggaatgatctaccatgagttttacgaggaatattactccaaactcgat
ctcaagaagtacgtcggaaaaacagatgatggtacgatcagaataagggtgccggaagga
ttttacttcctgatgggggacaacacaaaggaaagtcttgactgcagatatttcggtttt
gtccctaaggaccacatcataggatggccaattttgaggatctggccctttgaaagattc
ggtcctattcagaaatactaa

DBGET integrated database retrieval system