KEGG   Thermotoga maritima MSB8: TM1620
Entry
TM1620            CDS       T00022                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tma  Thermotoga maritima MSB8
SSDB
Motif
Pfam: CMD
Other DBs
NCBI-ProteinID: AAD36687
UniProt: Q9X1V5
Structure
PDB: 
1VKE 1P8C

Position
complement(1608357..1608722)
AA seq 121 aa
MEYKKFVEARRELNEKVLSRGTLNTKRFFNLDSAVYRPGKLDVKTKELMGLVASTVLRCD
DCIRYHLVRCVQEGASDEEIFEALDIALVVGGSIVIPHLRRAVGFLEELREMEKNGETIS
L
NT seq 366 nt   +upstreamnt  +downstreamnt
gtggagtacaaaaagtttgtggaagcaagaagagagctgaacgagaaggtgttatcccgt
ggaactctgaacacgaagagattcttcaatctcgactccgccgtttacaggcccgggaaa
ctcgatgtaaagaccaaagaactgatggggctcgtagcatccacggttctcaggtgcgat
gattgtataaggtaccaccttgtaaggtgtgttcaggaaggagcgagcgacgaagagatc
ttcgaagcccttgacatcgccctcgtggttggtggctctatcgtgataccgcacttgaga
agagctgtgggattccttgaagagctgagggagatggagaaaaatggcgagactatttct
ctttga

DBGET integrated database retrieval system