KEGG   Tenacibaculum maritimum: MARIT_0656Help
Entry
MARIT_0656        CDS       T05240                                 

Gene name
pck
Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
tmar  Tenacibaculum maritimum
Pathway
tmar00010  Glycolysis / Gluconeogenesis
tmar00020  Citrate cycle (TCA cycle)
tmar00620  Pyruvate metabolism
tmar01100  Metabolic pathways
tmar01110  Biosynthesis of secondary metabolites
tmar01120  Microbial metabolism in diverse environments
tmar01130  Biosynthesis of antibiotics
tmar01200  Carbon metabolism
Module
tmar_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tmar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MARIT_0656 (pck)
   00020 Citrate cycle (TCA cycle)
    MARIT_0656 (pck)
   00620 Pyruvate metabolism
    MARIT_0656 (pck)
Enzymes [BR:tmar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     MARIT_0656 (pck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP PEPCK_GTP
Motif
Other DBs
NCBI-ProteinID: SFZ80534
UniProt: A0A2H1E821
Position
673588..675198
Genome map
AA seq 536 aa AA seqDB search
MTNLETKTISLDNLGITNATVRYQLTPDQLQQITIEKGQGVEAASGALAVNTGEFTGRSP
MDRFIVKDDITKDEIWWGDVNIPFDAEKFDNLYEKVTKYLSGKEVFARDSYACADEDYKL
KIRVVNEYPWSNMFAYNMFLRPTSEELKGFSPEWTVINAPGFMADPAVDGTRQHNFAILN
FGRKIALIGGTGYTGEIKKGIFSALNFILPVFKNTLPMHCSANVGKEGDTAIFFGLSGTG
KTTLSTDPNRSLIGDDEHGWTAENKVFNFEGGCYAKVIDLSKEKEPEIYNAIKKGAILEN
VILDKEGNVDFADTSITQNTRVSYPIYHIENIQKPSIGKNPKNIFFLTADAFGVLPPISK
LTPGQAAYHFISGYTAKVAGTEAGVTEPLPSFSACFGAPFMPLHPTRYAEMLSEKMKETG
VNVWLINTGWTAGPYGVGHRMKLKYTRAMINAALHGELGEVNYENYHTHSVFGLAQPRKC
PGVPSEMLSQRKAWNNDEEYYKTAHKLADSFRKNFKSFEEYANEEILAGGPPIIEK
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcttgaaacgaaaacgatttcgttagataatttaggaattacaaatgcaaca
gtacgttaccagttaacgccagatcagttgcaacagattactatagagaaaggacaaggt
gttgaagccgcttcaggagcgttagctgttaatactggtgaatttacagggagatctcct
atggatcgttttatcgtaaaagacgatataaccaaagatgaaatttggtggggagatgtt
aatattccttttgatgcagaaaagtttgataacttatacgagaaagtaactaaatatctt
tcaggaaaagaagtttttgctcgtgatagttatgcttgtgcagatgaagattataagctg
aaaattagagtagtaaacgagtatccttggagtaatatgtttgcttataacatgttttta
cgtccaacttcagaagaattaaaaggattttctccggaatggaccgtgattaatgctcca
ggttttatggcagatccagcagtagatggcacgcgccagcataattttgcaattttaaat
ttcggtagaaaaatagcactaattggaggaactggatatactggagaaattaagaaagga
atcttttctgcattgaattttattttgccagtctttaaaaatacattgccaatgcactgt
tctgcaaatgtaggaaaagaaggagatacagctatatttttcggattgtcaggaacagga
aaaacaaccttatcaacagatcccaatagaagtttaataggagatgatgaacatggttgg
actgctgaaaataaggtgtttaattttgaaggaggatgctacgctaaagtaatagactta
tcaaaagaaaaagagccagaaatatacaatgcaataaagaaaggggctattttagaaaat
gtaattttggacaaagaaggaaatgtagattttgcggatacttctattacgcaaaatact
cgtgtaagctatcctatttatcatatagaaaatattcaaaaaccttctatcggaaagaat
ccaaaaaatatatttttcttaacagcggatgcttttggggtattgcctccaatatctaag
ttaacgccagggcaagcagcttaccattttatttcaggttatacagcaaaagtagcagga
acagaagcaggagtaacggaaccattaccgagtttttcagcttgttttggtgctcctttt
atgccattacatcctacgcgttatgcagaaatgctaagcgaaaaaatgaaggaaacaggt
gtgaatgtgtggttgataaatacaggatggacagctggtccttatggagttggccataga
atgaaattgaaatatacgagggcaatgattaatgcagcgttgcatggagaattaggagag
gtgaattatgagaattaccatacgcattctgtatttggattggcacaaccaagaaaatgc
ccaggagtgccttcagaaatgttaagtcaaagaaaggcttggaataatgatgaagagtat
tataagacagcgcacaaattggcagattcgttcagaaaaaactttaagagttttgaagaa
tatgctaatgaagagatattagcaggtggaccaccaataattgaaaaataa

DBGET integrated database retrieval system