KEGG   Tenacibaculum maritimum: MARIT_1618Help
Entry
MARIT_1618        CDS       T05240                                 

Definition
(GenBank) putative haloacid dehalogenase-type hydrolase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
tmar  Tenacibaculum maritimum
Pathway
tmar00010  Glycolysis / Gluconeogenesis
tmar01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tmar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MARIT_1618
Enzymes [BR:tmar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     MARIT_1618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Acid_PPase
Motif
Other DBs
NCBI-ProteinID: SFZ82496
UniProt: A0A2H1EAQ6
Position
complement(1713486..1714097)
Genome map
AA seq 203 aa AA seqDB search
MIKNIIFDFGDIFINLDKEATYREMAKLGVTDISSDMIATYYKYEMGLLTTNEFISFYKN
KFPTIQKEALINAWNAILLDFPQERLSFLKALKASKKYRLFLLSNTNDLHISWIQNDWGM
KLYHEFKDCFEKFYLSHEIHFRKPNRNIYEFVLKENDLMASETIFIDDTQENTDAAKELG
IHTWHLLPKEEVTDLLNRKELLL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaatatcatttttgattttggtgacatattcatcaatttagataaagaagct
acttatagagaaatggcaaagctaggagttactgatatttctagcgatatgatagcaacc
tactataagtatgaaatggggttattaactacaaatgagtttattagtttttataaaaat
aaattcccaacaattcaaaaagaagcacttataaatgcgtggaatgctattttattagat
tttcctcaagaaaggctttcttttttaaaagcgttaaaagcttctaaaaaatatagatta
tttttattgagtaatacgaatgatttgcatatttcatggattcagaatgattgggggatg
aaattgtatcatgaatttaaggattgctttgaaaaattttatttatcgcatgaaattcat
tttagaaaacctaatagaaacatttatgaatttgttttaaaggaaaacgacttaatggct
agtgaaactatttttattgacgatactcaagaaaatacagatgctgcaaaagaattagga
atacatacttggcatttgttaccaaaagaagaagtaactgatttgttaaatagaaaagaa
ttattgttatga

DBGET integrated database retrieval system