KEGG   Tenacibaculum maritimum: MARIT_2591Help
Entry
MARIT_2591        CDS       T05240                                 

Gene name
mvaA
Definition
(GenBank) 3-hydroxy-3-methylglutaryl-coenzyme A reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
tmar  Tenacibaculum maritimum
Pathway
tmar00900  Terpenoid backbone biosynthesis
tmar01110  Biosynthesis of secondary metabolites
tmar01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tmar00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MARIT_2591 (mvaA)
Enzymes [BR:tmar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     MARIT_2591 (mvaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red DUF1569
Motif
Other DBs
NCBI-ProteinID: SFZ84140
UniProt: A0A2H1EC24
Position
2806011..2807741
Genome map
AA seq 576 aa AA seqDB search
MSKIISGFSKLTKKEKINWLANNYFNDQPEIIKTLKQYWNADEKLQKLHDDFIENTISNF
YMPFGIAPNFIINGKEYVIPMVIEESSVVAAASLVAKFWSTRGGFKTTVISTTKIGQVHF
MYAGDPIALETYFNTRKAALYAATASITKNMEKRGGGILDIQLVKKTDKLENYYQLHVTF
ETKDSMGANFINSCLETIAKEFQKDGIEIVMSILSNYVPECLVKAEVSCKVAELGGENPQ
QFAEKFCQAVQIAEVEPYRAVTHNKGIMNGIDAVVLATGNDFRAIEAGAHAYASKSGTYK
SLTHCEIKNDVFRFWIEIPLALGTVGGLTTLHPMSKLSLDMMQQPSAQTLMQIIAAAGLA
QNFAALRALTTKGIQHGHMKMHLMNILNQYKASNDEKEIILHYFKDKTVSHSAVIEKLNS
LRKPTVSWVDFLNTNEMYSQLNKLNANTPPLFGKMNGQQMVEHLSLLLQISNGTIRAEQF
ISDEKSARRKPFLNTNNEIQLGFKAPSLSEEPYPVKFHTMDAAINDLIYQIQKFTAHFKT
SKKEHHPFFGDLNFDEWTKFHTKHFTHHFKQFDLLQ
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaattatatctggattttcaaaacttaccaaaaaagaaaaaataaattggtta
gcaaacaactattttaacgatcaacctgaaataataaagacccttaaacaatattggaat
gcagatgaaaagctacaaaaattgcatgacgattttatagaaaataccatttctaatttt
tatatgccttttggtattgctccaaattttatcattaatggtaaagagtatgtaattcct
atggtcattgaagagagctctgttgttgcagcagcttctttagttgcgaagttttggtcc
actcgtggcggttttaaaacaacagtgatttccactacaaaaattggacaagttcatttt
atgtatgcaggagaccctattgcattggaaacatatttcaatactcggaaagcagcttta
tatgccgctactgcttccatcacaaagaatatggaaaaaagaggcggtggtattttagac
attcaactagttaaaaaaactgataagcttgaaaattactatcaattacatgttactttt
gaaaccaaagatagtatgggagctaatttcattaactcttgtttagaaacaatagctaaa
gagtttcaaaaagacggtatagaaattgtgatgagtattctttctaattatgttcctgaa
tgtttagtaaaagccgaggtaagttgtaaagtagcggaactaggaggagaaaatcctcaa
caatttgctgaaaaattttgtcaagctgttcaaattgctgaagttgaaccttaccgagct
gtgactcataataaaggaatcatgaatggaattgatgctgttgtattggctacagggaat
gattttagagctattgaagctggggctcatgcttatgcttctaaaagcgggacttataaa
agtttaacacattgcgaaataaaaaatgatgtatttaggttttggattgaaattcctttg
gctctaggaactgttggcggattaaccactttacaccctatgtccaaattatctttagat
atgatgcagcaaccatctgcacaaactttaatgcaaattattgccgcagctggtttagct
cagaattttgctgctttgagagccttaaccaccaaaggaattcaacacggacatatgaaa
atgcacttaatgaacatattgaatcaatacaaagcttccaatgatgaaaaagaaattatt
cttcattattttaaagataaaactgtttcacacagcgctgttattgaaaaattaaattca
ttgagaaaacctacagtttcttgggtagattttttaaatactaatgagatgtattctcaa
ttaaataaactaaacgcaaacactcctcccttgtttggtaaaatgaatgggcaacaaatg
gttgaacaccttagtttattgttacaaatttctaatggaacaatacgtgctgagcaattt
atttctgatgaaaaatcagctcgtagaaagcccttcctaaatacaaataatgaaattcag
cttggttttaaagcccccagcttatcagaagagccttaccctgtaaaatttcatactatg
gatgctgctattaacgatttaatatatcaaattcaaaagttcactgctcattttaagact
agcaaaaaggagcatcatccattttttggagatttaaattttgatgaatggacaaagttt
cataccaaacattttacacatcactttaaacaatttgacttactacaataa

DBGET integrated database retrieval system