KEGG   Tenacibaculum maritimum: MARIT_2905Help
Entry
MARIT_2905        CDS       T05240                                 

Definition
(GenBank) Phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
tmar  Tenacibaculum maritimum
Brite
KEGG Orthology (KO) [BR:tmar00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    MARIT_2905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: SFZ84779
UniProt: A0A2H1ECY7
Position
3127049..3128044
Genome map
AA seq 331 aa AA seqDB search
MILLLLFIAACFLAYSNGANDNFKGVATLFGAGITNYKKAINWATITTFSGSVAAIFLAK
ELVKNFSGKGLVPNELIQTPNFAIAIALGAALTVFAATKIGMPISTTHGLVGGLFGAGVM
AVGSDFNFGKLGNTFLMPLVVSPLMAAILSLLAYLLFKFIKKQIPSLHTKNPTLFGISAP
KILDRLHYLSAGIVSFARGLNDTPKIVGLLIIINTIDIKWSMISVAVIMSLGGLLNAKKV
GETMSKKITKMNSGQGFTANIVTGLLVTTASVHGLPVSTTHVSVGSLFGIGTATKKADYK
VIGKIILSWVLTLPIAAIMSAVIFKVLQVVA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgatcttattacttcttttcattgctgcttgctttttagcttacagtaatggtgcaaat
gacaattttaaaggtgtagctaccttatttggtgctggtatcaccaactataaaaaagct
ataaattgggctactattaccactttttctggttctgtagccgccatttttttagccaaa
gaactcgttaaaaacttttcaggaaaaggactggttcctaatgaacttatacaaacaccc
aactttgctattgctattgccttaggagctgcacttactgtttttgctgccactaaaata
ggcatgccaatttctactactcatggtttagtaggagggttattcggtgctggtgttatg
gctgttggatctgattttaatttcggaaagttaggaaatacatttttaatgccgttggtt
gttagtccgttaatggctgctattttaagtttattggcctatctattatttaagtttata
aaaaaacaaattcccagcttacatacaaaaaaccctactttatttggtattagtgctcct
aaaatacttgatcgcttgcattaccttagtgctggtattgtaagttttgctagaggctta
aacgatacgcccaaaattgtaggtttactaattattatcaataccattgacatcaaatgg
agtatgatttccgtagccgttatcatgtcacttggtggacttttaaacgctaaaaaggta
ggagaaacaatgagtaaaaaaattaccaaaatgaattccggacaaggctttactgccaac
atagttactggtttattggtaactaccgctagtgttcatggattgcctgtttctacaaca
cacgtttctgttggctctttgtttggaattggaactgctacaaaaaaagcagattataaa
gtaattggaaaaattattttatcttgggtactcacactacctattgctgcaattatgagc
gctgttatttttaaagtattacaagtagttgcttaa

DBGET integrated database retrieval system