KEGG   Tenacibaculum maritimum: MARIT_2955Help
Entry
MARIT_2955        CDS       T05240                                 

Gene name
wbpD
Definition
(GenBank) UDP-2-acetamido-3-amino-2,3-dideoxy-D-glucuronate N-acetyltransferase
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
tmar  Tenacibaculum maritimum
Pathway
tmar00520  Amino sugar and nucleotide sugar metabolism
tmar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MARIT_2955 (wbpD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:tmar01005]
    MARIT_2955 (wbpD)
Enzymes [BR:tmar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     MARIT_2955 (wbpD)
Lipopolysaccharide biosynthesis proteins [BR:tmar01005]
 Unusual sugar
  MARIT_2955 (wbpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2 DUF4954
Motif
Other DBs
NCBI-ProteinID: SFZ84884
UniProt: A0A2H1ED39
Position
complement(3171250..3171822)
Genome map
AA seq 190 aa AA seqDB search
MKEYFAHETAVIDEGATIGNKTKIWHFSHIMPNCKIGDNCNIGQNVVISPEVVLGNNVKV
QNNVSIYTGVVCEDDVFLGPSMVFTNVINPRSAINRKSEYKKTIVRKGASIGANATIVCG
NNIGHYAFIGAGAVVTKEIPPYALVVGNPSKQIGWVSEYGHRLIFDEEGWATCFESKDKY
QLKGGKVYRM
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatattttgcacatgaaacggctgtgatagacgaaggagctacaataggaaac
aaaacaaagatatggcactttagccatatcatgccgaattgtaagataggagataattgt
aatatagggcaaaatgtagtcatttctccagaagttgttctaggaaataatgtaaaggtg
caaaacaatgtatctatttatacaggagtagtttgcgaagatgatgtctttttaggtcct
tctatggtttttactaacgttataaatccgcgaagtgctatcaatagaaaaagtgaatat
aaaaaaacaattgtaaggaaaggggctagtattggagctaatgcaactatagtatgtgga
aataatatagggcactatgcttttattggagcgggggcagtagttacaaaagaaataccg
ccttatgcactagtagtagggaatccttcgaagcaaataggatgggtgagtgaatatggg
catcgacttatatttgacgaagaaggttgggctacttgttttgaaagtaaagataaatat
caactaaagggaggtaaggtatatcggatgtga

DBGET integrated database retrieval system