KEGG   Thioflavicoccus mobilis: Thimo_0415Help
Entry
Thimo_0415        CDS       T02397                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tmb  Thioflavicoccus mobilis
Pathway
tmb00010  Glycolysis / Gluconeogenesis
tmb00052  Galactose metabolism
tmb00500  Starch and sucrose metabolism
tmb00520  Amino sugar and nucleotide sugar metabolism
tmb00521  Streptomycin biosynthesis
tmb01100  Metabolic pathways
tmb01110  Biosynthesis of secondary metabolites
tmb01120  Microbial metabolism in diverse environments
tmb01130  Biosynthesis of antibiotics
tmb01200  Carbon metabolism
Module
tmb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thimo_0415
   00052 Galactose metabolism
    Thimo_0415
   00500 Starch and sucrose metabolism
    Thimo_0415
   00520 Amino sugar and nucleotide sugar metabolism
    Thimo_0415
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thimo_0415
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Thimo_0415
Enzymes [BR:tmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Thimo_0415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: AGA89276
UniProt: L0GTE1
Position
complement(449877..450917)
Genome map
AA seq 346 aa AA seqDB search
MIQIKCSPRANERAAKSLGTGSVMQILVGDIGGTKTTLTLAEVAEQRVALGDVHRYASRE
HDNFESVVQRFLAETGATCTQAAFAVAGPVLDDRSQTTNLPWSPDARALERALDLSRVRL
LNDLEAIGWGLPALADEDLATLYPGAAPSTGNACIVAAGTGLGQAGLYWDGSRHHPFATE
GGHGDFAPTDGREQALFEDLRQRFGHVSWERVVSGPGIANIHRSIAAQQGVPAWFSEETR
HRDVAEVVAEAAAQGRCPQCIETMELFLRLYGREAGNMALKQMALGGVYLGGGIAPKNLE
ALRAGPFLEAFFDKGRLAPLMQRIPVRVILSEKAPLYGAARFMAAD
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgatccagatcaaatgctcgccgcgagcgaacgagcgtgcggcgaagtccctcggtact
ggcagcgtgatgcagatattggttggtgacatcggcggcacgaagacgaccctgaccttg
gccgaggtcgccgagcagcgcgtggcgctgggtgacgtccaccgctacgcgagccgcgag
cacgacaacttcgagtccgtcgtgcagcgctttctcgccgaaacgggagcgacctgcacc
caagccgctttcgccgtcgccggcccggtcctggacgatcgcagccagacgacgaacctg
ccctggtcgccggacgcacgcgccctcgagcgcgccctcgacctgtcgcgggtgcgacta
ctgaacgacctcgaggcaatcggctgggggctgccggcgctcgctgacgaggacctagcg
actctctatccgggcgcggcgccgagcaccggaaacgcctgcatcgtcgccgccgggacc
ggcctgggacaagccggactctattgggacgggtcgcggcaccatccgttcgcgaccgag
ggtggacacggcgatttcgcccccaccgacgggcgcgagcaggccctgttcgaagacctc
cgccaacggtttggccatgtcagctgggagcgcgtcgtatccggacccggtatcgcaaat
attcatcgctccatcgcggctcaacagggggtgcccgcttggttcagcgaggagacccgg
catcgcgacgtcgcggaggtggtagccgaggccgccgcgcagggtcgctgtccgcagtgt
atcgagacgatggagctgttcctgcgcctctatggccgcgaggccggcaacatggcgctc
aagcagatggccctgggtggtgtctatctcggcggcggcatcgccccgaagaatctggag
gcgctgcgcgcaggtcccttcctcgaggcctttttcgacaagggtcggttggcaccactg
atgcagcgcatccccgtcagggtgatcctgtccgagaaggccccgctctacggggcagcg
cgcttcatggccgccgattga

DBGET integrated database retrieval system