KEGG   Thioflavicoccus mobilis: Thimo_1086Help
Entry
Thimo_1086        CDS       T02397                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tmb  Thioflavicoccus mobilis
Pathway
tmb00010  Glycolysis / Gluconeogenesis
tmb00020  Citrate cycle (TCA cycle)
tmb00620  Pyruvate metabolism
tmb01100  Metabolic pathways
tmb01110  Biosynthesis of secondary metabolites
tmb01120  Microbial metabolism in diverse environments
tmb01130  Biosynthesis of antibiotics
tmb01200  Carbon metabolism
Module
tmb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thimo_1086
   00020 Citrate cycle (TCA cycle)
    Thimo_1086
   00620 Pyruvate metabolism
    Thimo_1086
Enzymes [BR:tmb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Thimo_1086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_D23 GCV_H PYNP_C
Motif
Other DBs
NCBI-ProteinID: AGA89890
UniProt: L0GWZ1
Position
complement(1172775..1174148)
Genome map
AA seq 457 aa AA seqDB search
MATTEEILLPDLGDFAEIPVIEILVEPGERVTPEQSLVTLESDKATMEIPAPKGGIVREL
RVAVGDKVSTGDPLLALETNEAPQQEAATASTPDSAPDSPPAETAQPSPDEEAPPTEETP
PDDSPETATARRPGDKAARPAPLRPRPADLAAVAQGRTPHASPAVRRFARELGVELARVK
GSGPKGRILKEDVQAFVQQALRQGSAVSPGGQPFDLPAAPEVDFSRFGPVEEVPLARIQR
ISGAHLHRCWLTVPHVTQFDEADITELEAFRRAQQQEGEHDVKLTFLPFLLKAVATALVA
QPRLKASLTPDGESLILKHYTHIGVAVDTPNGLVVPVVRDVDEKGVLALARELADLSAKA
RAGKLLPGDMQGGCFSISSLGGIGGTAFTPIVNAPEVAVLGVARATQHPVWDGSAFVPRT
MLPLALSYDHRVVDGAEGARFTQRLARLLGDIRRLLL
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
ttggcaactacagaagagattctgctgccggatctcggcgatttcgccgagatcccggtc
atcgagatcctggtcgagcccggcgaacgggtcacacccgagcagtcgctggtcacgctc
gagagcgacaaggcgacgatggagatcccggcgccgaagggcggcatcgtccgcgagctg
cgcgtcgcggtgggcgacaaggtcagtaccggtgacccgctgctagcgcttgagacaaat
gaggcaccgcagcaggaggcggccaccgcatcgacacccgattcagcgcccgattcgccc
cctgctgagacagcacaaccgtctccggacgaagaggcgcctccaaccgaggagacgccg
cccgacgacagccccgagacggcgacagcgcggcggcccggcgacaaggccgcgcgcccg
gccccgctgcgcccgcgccccgccgacctggcggccgtcgcccagggccgcacgccccac
gcgagcccggccgtgcgccgcttcgcccgcgaactcggcgtcgagctcgcgcgcgtcaag
gggagcggccccaagggccggatcctcaaggaagacgtccaggccttcgtccagcaggcg
ctgcgccagggcagcgctgtctcgccgggcgggcaaccgttcgatctgccggccgcgccc
gaggtcgacttcagccgcttcggaccggtcgaagaggtgccgctggcccgcatccagcgc
atcagcggtgcccacctgcaccgctgctggctgacggtaccccatgtcacccagttcgac
gaggccgacatcaccgagctggaggcctttcgccgcgcccagcagcaggaaggggagcac
gacgtcaagctcaccttcctgcccttcctgctcaaggcggtcgcgaccgcgctcgttgcg
cagccgcggctcaaggcctcgctgacgccggatggcgagagcctgatcctcaagcactac
acccacatcggcgtcgccgtcgacacgccgaacgggctggtcgtgccggtagtgcgcgac
gtcgacgagaagggcgtcctggcgctcgctcgggagctcgccgacctgagcgccaaagcc
cgggccgggaagctcctgcccggcgacatgcagggcggctgcttcagcatctcgagcctc
ggcgggatcggcggcaccgccttcacgccgatcgtcaatgcccccgaggtcgcagtcctc
ggcgtcgcccgcgcgacccagcacccggtctgggacggcagcgccttcgtgccgcgcacc
atgctgccgctcgccttgtcctacgaccaccgggtcgtcgacggtgccgaaggggcgcgc
ttcacgcagcgtctcgccaggctgctcggcgacatccgccgcctgttgctgtga

DBGET integrated database retrieval system