KEGG   Thioflavicoccus mobilis: Thimo_1177Help
Entry
Thimo_1177        CDS       T02397                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tmb  Thioflavicoccus mobilis
Pathway
tmb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tmb01100  Metabolic pathways
tmb01110  Biosynthesis of secondary metabolites
tmb01130  Biosynthesis of antibiotics
tmb01230  Biosynthesis of amino acids
Module
tmb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thimo_1177
Enzymes [BR:tmb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Thimo_1177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh
Motif
Other DBs
NCBI-ProteinID: AGA89977
UniProt: L0GVY7
Position
1278768..1279571
Genome map
AA seq 267 aa AA seqDB search
MSSAPDILKKIVARKREEVAERAARRSLAELASAAAGAARPRGFADALAAKIAESQPGVI
AEIKRASPSKGLLREDFRPAAIAGSYARDGAACLSVLTDRDFFQGSEAALEEARGACALP
VIRKDFIVDPYQVYEARAIGADCILLIAACLDDAELRDLNALAAELGLDVLVEVHDGAEL
ERALQVPGRLIGVNNRDLRTFSVALETTLELLPRIPSERLLVTESGIHSRADVERMRAAG
VNAFLVGEAFMRAPDPGEALRALFFAH
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctgcgcccgatatccttaagaaaattgtcgcccgtaagcgcgaagaggtcgcc
gagcgtgccgcgcgtcggtcgttggcagagctggcgagtgcggcggccggcgccgcgcgg
ccgcgcggctttgctgacgccctcgcggctaagatcgccgaaagccaaccgggggtgatc
gccgagatcaagcgggccagcccgagcaagggcttgttgcgcgaggactttcgcccggcg
gcgatcgccgggagctatgcacgggatggggcagcttgtctgtcggtgctgaccgaccgc
gacttcttccagggtagcgaggcggccctcgaggaggcccgcggcgcctgtgcgttgccg
gtgatccgcaaggacttcatcgtcgacccctatcaggtctacgaggcgcgcgcgatcggt
gcggactgcattctgctgatcgcggcctgcctcgacgatgccgagcttcgcgacctcaac
gccttggccgccgaactcgggctcgacgtcctggtcgaggtccatgacggggccgagctc
gagcgggcgctacaggtgcccggccggctcatcggcgtcaacaatcgcgatctgcgcacc
ttctcggtggccttggagacgacgctcgagctgttgccgcggattccgtccgaacgcctg
ctggtcacagagagcggcatccacagccgcgccgacgtggagcggatgcgggccgccggc
gtcaatgccttcctcgtcggcgaggccttcatgcgggcgcccgatccgggcgaggcgctg
cgggcgcttttcttcgcgcattga

DBGET integrated database retrieval system