KEGG   Thioflavicoccus mobilis: Thimo_1642Help
Entry
Thimo_1642        CDS       T02397                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tmb  Thioflavicoccus mobilis
Pathway
tmb00071  Fatty acid degradation
tmb00280  Valine, leucine and isoleucine degradation
tmb00310  Lysine degradation
tmb00362  Benzoate degradation
tmb00380  Tryptophan metabolism
tmb00620  Pyruvate metabolism
tmb00630  Glyoxylate and dicarboxylate metabolism
tmb00640  Propanoate metabolism
tmb00650  Butanoate metabolism
tmb00900  Terpenoid backbone biosynthesis
tmb01100  Metabolic pathways
tmb01110  Biosynthesis of secondary metabolites
tmb01120  Microbial metabolism in diverse environments
tmb01130  Biosynthesis of antibiotics
tmb01200  Carbon metabolism
tmb01212  Fatty acid metabolism
tmb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tmb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Thimo_1642
   00630 Glyoxylate and dicarboxylate metabolism
    Thimo_1642
   00640 Propanoate metabolism
    Thimo_1642
   00650 Butanoate metabolism
    Thimo_1642
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Thimo_1642
   00072 Synthesis and degradation of ketone bodies
    Thimo_1642
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Thimo_1642
   00310 Lysine degradation
    Thimo_1642
   00380 Tryptophan metabolism
    Thimo_1642
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Thimo_1642
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Thimo_1642
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Thimo_1642
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tmb04147]
    Thimo_1642
Enzymes [BR:tmb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Thimo_1642
Exosome [BR:tmb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Thimo_1642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C Phage_TTP_1
Motif
Other DBs
NCBI-ProteinID: AGA90420
UniProt: L0GYG0
Position
1823754..1824938
Genome map
AA seq 394 aa AA seqDB search
MSESIVIVAAARTAVGSFGGGLSSLPATELGATVVKALLERAGIGADQVDEVIFGQVLAA
GVGQNPARQTTLAAGLPEKVPAMTINKVCGSGLKAVHLAMQAVACGDAEVVIAGGQESMS
QSTHVLPRSRSGQRMGDWTMKDTMIVDGLWDAFNQCHMGVTAENVATKYGLTREAQDAFA
LESQQKTEGAQKAGRFADEIVPVAIPQRKGDPIVFDTDEFPRHGTKAEALAKLRPAFAKE
GTVTAGNASGINDGAAAVIVMTESKAQALGLKPLARLVAFASAGVDPAIMGTGPIPASTK
CLEKAGWTPSDLDLIEANEAFAAQALSVNKEMGWDPSKVNVNGGAIAIGHPIGASGARVL
VTLLYEMQRRDAKKGLATLCIGGGQGVALAIERD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaatcaatcgtgatcgtggcggcggctcgtaccgccgttggcagctttggtggc
ggtctgtcttctcttccggcgaccgaactcggtgcgactgtggtcaaggccctcctggaa
cgtgcgggtattggtgctgaccaggtcgacgaagtgatcttcgggcaggtgttggcggct
ggtgtcgggcagaatccggcgcgccagacgacgctcgccgccgggttgcccgagaaggtg
ccggcgatgaccatcaacaaggtctgtggcagcgggttgaaggccgtccacctggccatg
caggccgtcgcttgcggcgatgccgaggtcgtcatcgctggcggccaagagagcatgagt
cagtccacgcacgtgttgccgcggtcgcgctcgggccaacggatgggcgattggacgatg
aaggatacgatgatcgtcgacgggctttgggacgccttcaaccagtgccacatgggcgtc
acggccgagaacgtggcgaccaaatatggtttaacgcgcgaggcccaggatgccttcgcg
ctcgagtctcagcagaagaccgagggggcccagaaggcggggcgtttcgccgacgagatc
gtcccggtagcgatcccgcaacgcaagggcgacccgatcgtcttcgacaccgacgagttt
ccgcgccacgggaccaaggccgaggcgctcgccaagctccgcccggccttcgcgaaagag
ggtaccgtcactgctggcaacgcctcgggcatcaacgacggcgccgcggcggtgatcgtc
atgaccgagtccaaggcccaggcgctcggcctgaagccgttggcgcgcctcgtcgccttc
gcgagcgctggagtcgacccggcgatcatgggcaccgggccgattccggcctcgaccaag
tgtctggagaaggccggttggacgccgtctgatctcgacctaatcgaggccaacgaggcc
ttcgccgcccaggcgctatcggtcaacaaggagatgggctgggacccgagcaaggtcaac
gtcaatggcggagcgatcgccatcggacatccgatcggcgcctcgggtgcacgcgtgttg
gtgacgttactctacgagatgcagcgtcgcgatgcgaaaaagggtctggcgaccctctgc
atcggcggtggccagggtgtggcactggcgatcgagcgcgactga

DBGET integrated database retrieval system