KEGG   Thioflavicoccus mobilis: Thimo_2207Help
Entry
Thimo_2207        CDS       T02397                                 

Definition
(GenBank) sugar kinase, ribokinase
  KO
K00846  ketohexokinase [EC:2.7.1.3]
Organism
tmb  Thioflavicoccus mobilis
Pathway
tmb00051  Fructose and mannose metabolism
tmb01100  Metabolic pathways
tmb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tmb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Thimo_2207
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tmb04147]
    Thimo_2207
Enzymes [BR:tmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.3  ketohexokinase
     Thimo_2207
Exosome [BR:tmb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Thimo_2207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB PIRT
Motif
Other DBs
NCBI-ProteinID: AGA90954
UniProt: L0H052
Position
complement(2448910..2449833)
Genome map
AA seq 307 aa AA seqDB search
MNGRDRDGRPAGDGAGSRELGAVLGVGIATLDIVNEVATYPAEDAEVRAQAQRRVRGGNV
TNSLVVLAQLGHRCRWVGTLGEDAAAEAIIADLARYQVATDDAVRVAGGTTPTSYIALSR
ASGSRTIVHFRDLPELDAAAFERVALDGVGWVHFEGRNPPETRRMIERVRAEYPAMPISL
ELEKPRPGLDSLLDGPQVLLASRAFAAASGFRDPAAFLADLAPRTSATLCIVAWGEEGAS
WLARGGPVQQAPVHRPPRVIDTIGAGDVFNAGVIDALVRGLATAEAVAAAVHLAGEQCGR
IGLMLKG
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaacggaagggatcgagatgggcggccagccggcgacggagcggggtcccgggagctt
ggggcagtgctcggcgtcgggatcgcgacgctcgatatcgtcaacgaggtcgccacctat
ccggccgaagacgccgaggtgcgggcgcaggcccagcgccgcgtgcgtggtggcaatgtc
accaacagcctggtcgtgctggcgcagctcggtcatcgttgccgttgggtcgggaccctc
ggcgaggacgcggccgccgaagcgatcatcgcggacttggcgcgttaccaagtggcgacc
gatgatgcggtgcgggttgccggcggcacgacgccgacctcctacatcgcgttgagccgc
gccagcggcagtcgcacgatcgtccacttccgcgacttgccggagctcgacgcggcagcc
ttcgaacgtgtcgcgttggatggcgtcggctgggtccatttcgagggccgcaatccgccc
gagacgcggcggatgatcgagcgcgtgcgggccgagtatccggcaatgccgatctcgctg
gagctcgagaaaccacgccccgggctcgactcgctgctcgatggtccgcaggtcctgctc
gcgagccgggccttcgccgcggcgagcggcttccgagacccggcggccttcctcgcagac
ctcgcaccgcgcacgagcgcgacgctctgcatcgtcgcctggggcgaggagggcgcgagc
tggctcgcgcgcggcggcccggtgcagcaggcccccgtccaccgacctccgcgggtcatc
gacacgatcggggcgggcgatgtcttcaatgccggcgtcatcgacgcgctcgtccgcggc
ctcgccacggccgaggccgtggccgccgccgtgcacctggccggcgagcaatgcggtcgg
atcggtctgatgctcaagggctga

DBGET integrated database retrieval system