KEGG   Thioflavicoccus mobilis: Thimo_3022Help
Entry
Thimo_3022        CDS       T02397                                 

Definition
(GenBank) light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
tmb  Thioflavicoccus mobilis
Pathway
tmb00860  Porphyrin and chlorophyll metabolism
tmb01100  Metabolic pathways
tmb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Thimo_3022
Enzymes [BR:tmb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Thimo_3022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MeaB AAA_24 MipZ AAA_26 AAA_16 AAA_25 CBP_BcsQ SRP54
Motif
Other DBs
NCBI-ProteinID: AGA91713
UniProt: L0GY71
Position
complement(3304012..3304905)
Genome map
AA seq 297 aa AA seqDB search
MSHSGQPQGSPLDGEGSVQVALDPTIRIGKAKVFAVYGKGGIGKSTTSSNLSVAFSKLGK
RVIQIGCDPKHDSTFTLTKRLVPTVIDVLESVNFHPEELRPRDFVYEGYNGVQCVEAGGP
PAGTGCGGYVVGQTVKLLKQHHLLDDTDVVVFDVLGDVVCGGFAAPLQHAHRALIVTAND
FDSIFALNRIAAAIMAKARNYQVRIGGVIANRSAATDEIDRFTDAVGLRRLAHFPDLDVI
RRSRLKKSTLFEMEPAPGLEAAQQEYMRLATALWEGTEPLMARPMKDRDIFDFLGFD
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcattcgggtcagcctcaggggtcgccgttggacggtgagggcagcgtccaggtg
gcgctcgacccgacgatccggatcggcaaggcgaaggtcttcgccgtctacggcaaaggt
ggcatcggcaagagcacgacctcgtcgaacctgtcggtcgccttctcgaagctcggcaag
cgcgtcatccagatcggctgcgacccgaagcacgactcgaccttcacgctgaccaaacgg
ctggtgccgaccgtcatcgatgtgctcgagtcggtcaatttccatccggaggagctgcgc
cctcgcgacttcgtctatgagggctataatggcgtccagtgtgtcgaggccggggggccg
ccggcgggtaccggctgtggcggttatgtcgtggggcagacggtgaagttgctcaagcag
catcacctgctcgacgacaccgacgtcgtggtcttcgatgtgctcggcgacgtggtttgc
ggcggtttcgccgcgccgctgcagcacgcccatcgggcgctgatcgtcacggccaacgac
ttcgattccatcttcgcgctgaatcgtatcgcggccgccataatggccaaggcgcgtaac
taccaggtgcgtattggcggggttatcgccaatcgcagcgcggccacggacgagatcgac
cggttcacagatgcagtcggcctgcggcgattggcccactttccggacctggacgtgata
cggcgcagccgcttgaagaaatcgaccctgttcgagatggagccggccccggggctggag
gccgcccagcaagagtatatgcgcttggccaccgccctctgggaagggaccgagccgctc
atggccaggccgatgaaggatcgcgacattttcgactttcttggattcgattga

DBGET integrated database retrieval system