KEGG   Tatlockia micdadei: LMI_0138Help
Entry
LMI_0138          CDS       T03810                                 

Definition
(GenBank) putative aromatic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
tmc  Tatlockia micdadei
Pathway
tmc00130  Ubiquinone and other terpenoid-quinone biosynthesis
tmc00627  Aminobenzoate degradation
tmc01100  Metabolic pathways
tmc01110  Biosynthesis of secondary metabolites
tmc01120  Microbial metabolism in diverse environments
tmc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tmc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    LMI_0138
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    LMI_0138
Enzymes [BR:tmc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     LMI_0138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: CEG59505
UniProt: A0A098GC15
Position
I:complement(129147..129725)
Genome map
AA seq 192 aa AA seqDB search
MAIQRKPRIIIGISGASGIIYGIRLLECLKECEVETHLIVSKAAQQTRAFETTLSASQLN
HLADKHYNINDIAACLSSGSYQTLGMIIAPCSMRTLGNIASGNSDTLLTRAADVILKERK
RLILMVRESPLHLGHLKNMLAVTEMGAIIAPPVPAFYNHPQTIDDIINHTVGRILDLLDL
DLGLVRRWGEDS
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtggcaattcagagaaaaccccgtattattattggcatcagcggtgcctctggcatcata
tacgggattcgcctactggaatgcttaaaagaatgcgaggttgaaacgcatttaatcgta
tctaaagctgcccaacaaacgcgcgcttttgaaacaactctttcagcgtcacagcttaat
catttggctgataagcactacaatattaacgatattgctgcctgcctctcaagcggctcc
tatcaaacattagggatgatcatcgccccttgttcgatgcgaaccttaggcaatattgct
tctggtaattcggatacgttattaacccgtgcagcagatgtcatattaaaagaaaggaaa
cgcctcattttaatggttagagaatcaccgcttcatctcggccatttaaaaaacatgctc
gcagtcactgaaatgggggcaatcattgctcctccggttccggcattttataaccatcct
caaaccatagatgatataattaatcatacggtgggcagaattttagatttacttgatctt
gatctcggccttgttcgccgctggggcgaagattcttaa

DBGET integrated database retrieval system