KEGG   Tatlockia micdadei: LMI_1446Help
Entry
LMI_1446          CDS       T03810                                 

Definition
(GenBank) Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tmc  Tatlockia micdadei
Pathway
tmc00071  Fatty acid degradation
tmc00072  Synthesis and degradation of ketone bodies
tmc00280  Valine, leucine and isoleucine degradation
tmc00310  Lysine degradation
tmc00362  Benzoate degradation
tmc00380  Tryptophan metabolism
tmc00620  Pyruvate metabolism
tmc00630  Glyoxylate and dicarboxylate metabolism
tmc00640  Propanoate metabolism
tmc00650  Butanoate metabolism
tmc00900  Terpenoid backbone biosynthesis
tmc01100  Metabolic pathways
tmc01110  Biosynthesis of secondary metabolites
tmc01120  Microbial metabolism in diverse environments
tmc01130  Biosynthesis of antibiotics
tmc01200  Carbon metabolism
tmc01212  Fatty acid metabolism
tmc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMI_1446
   00630 Glyoxylate and dicarboxylate metabolism
    LMI_1446
   00640 Propanoate metabolism
    LMI_1446
   00650 Butanoate metabolism
    LMI_1446
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LMI_1446
   00072 Synthesis and degradation of ketone bodies
    LMI_1446
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LMI_1446
   00310 Lysine degradation
    LMI_1446
   00380 Tryptophan metabolism
    LMI_1446
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMI_1446
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LMI_1446
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LMI_1446
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tmc04147]
    LMI_1446
Enzymes [BR:tmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LMI_1446
Exosome [BR:tmc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMI_1446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CEG60752
UniProt: A0A098GFJ3
Position
I:1524883..1526199
Genome map
AA seq 438 aa AA seqDB search
MKQKSNLSGREVYVVDGSRTPFLKAKGVGPFTGSDLAVAAGMTLLNRQPISPTQLDEVII
GSAMPGPDEANIARVIALRLGCGEKVPAFTVMRNCASGMQALDNAALQIASGRSDLVLAG
GTDAMSHAPLMFNEKMAAWLARWFNAKTVGQRFGLVTQFRPSYLAPVIALLRGLTDPIVG
MNMGQTAEKVAYRFNITREQMDEFASESHQHLAKAYMEGRMDEVVPVIDSKGHLYQQDDG
IRPDSTVEKLGKLKPFFDKKYGMVTAGNSSQITDGACLLLLASAEAVKKYHLSVIGRIVD
SQWAALDPAQMGLGPVHAATPILQRHHLKPADMDCWEINEAFAAQVLGCLAAWDDDDYCR
TQLGLKQAMGAPSLAQLNKDGGAIAAGHPIGASGARIVLHVLQSLKQHNGTRGMAAICIG
GGQGGAMYLERVTEVKEQ
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagaaatcgaatttaagcggcagagaggtgtatgtagtggatggcagccgaact
ccatttctcaaagcaaaaggagttggcccttttaccggatcagatttggctgtagccgca
ggcatgacgctgttaaatcgtcagcctatctcccctacccaattagatgaggtcattatt
ggttctgctatgccaggtcctgatgaagcaaatatcgctagggtcattgctttacgatta
ggctgtggtgaaaaagttcctgcgtttactgttatgagaaactgtgcatcggggatgcaa
gcacttgataatgcagcattgcaaattgccagtggtcgaagcgatttagtgttagcagga
ggtacagatgcgatgagccatgccccgttaatgtttaatgaaaaaatggctgcatggcta
gctcgatggtttaatgcaaaaacagtcggccaacgttttggcctagtgacacagtttaga
ccgtcataccttgctcctgttattgccttgctgcgtggtttaaccgatcccattgtcggt
atgaacatgggacaaaccgcggagaaggtagcctatcgttttaatattacccgtgaacaa
atggatgagtttgctagtgagagccatcagcacctagctaaggcgtatatggaaggaaga
atggatgaggttgtgcccgtgatagatagcaaaggccatctctatcagcaagacgacgga
attcgccctgactccacagtagaaaagctaggaaaattaaaaccctttttcgataaaaaa
tacggtatggttactgcaggtaatagttcgcaaattactgacggagcttgtttattacta
cttgctagtgctgaggctgttaaaaaatatcatctttcagttatcggccgtattgtcgac
tctcagtgggctgcccttgatcctgcccaaatgggattaggccctgttcatgccgcgaca
cccattttgcagcgtcatcatttgaaaccagctgatatggattgctgggaaattaacgaa
gcatttgcagctcaggtacttggctgtttagctgcttgggacgatgacgattactgtcga
acgcaattaggattaaaacaagcaatgggggcgccttcgcttgcgcaacttaataaagat
ggaggggctattgctgcagggcacccgattggagccagtggtgctcgcattgtattacat
gttttgcaatcacttaaacaacataacggtactcgaggcatggctgcgatttgtattggt
ggcggacagggcggagcaatgtatctggaacgagtgacagaggtgaaagagcaatga

DBGET integrated database retrieval system