KEGG   Tatlockia micdadei: LMI_1477Help
Entry
LMI_1477          CDS       T03810                                 

Definition
(GenBank) Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tmc  Tatlockia micdadei
Pathway
tmc00010  Glycolysis / Gluconeogenesis
tmc00020  Citrate cycle (TCA cycle)
tmc00620  Pyruvate metabolism
tmc01100  Metabolic pathways
tmc01110  Biosynthesis of secondary metabolites
tmc01120  Microbial metabolism in diverse environments
tmc01130  Biosynthesis of antibiotics
tmc01200  Carbon metabolism
Module
tmc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMI_1477
   00020 Citrate cycle (TCA cycle)
    LMI_1477
   00620 Pyruvate metabolism
    LMI_1477
Enzymes [BR:tmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LMI_1477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: CEG60782
UniProt: A0A098GFL8
Position
I:complement(1558351..1559478)
Genome map
AA seq 375 aa AA seqDB search
MNIFNLPDLGEGLPDAEIHEWFVKEGDTVTVDQPLVSMETAKAVVDVPCPQSGKIVKLFG
NPGDVIKTGEPLVGFEAAAESDKKVDKGTVVGNLEESTDISEDNFIIGSSRKNSQRIKTT
PAVRLLAKKLGVDLNSLMGSGGHGVITLEDVQAAAEKKAQLPEGYEALRGVRRAMLNSMV
QSHQEIVPVSIFDEADIECWPAGTDITVRLIRAIIHASKQEPALNAWFDTAHSARKCFSE
VHLGIAMDSSEGLFVPVIHNAATHSDEQLRKIIDDYKQAVSERVVAPEKLKGATITLSNF
GKFAGRFASPIIVPPMVAILAVGRLYQGVVALNGKVETHRLLPLSLSFDHRAVTGGEATR
FLGAVIEALQKPEIM
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttcaatttacctgatttgggcgaagggttgcccgatgctgaaattcatgaa
tggtttgttaaagaaggcgatactgtaactgtcgatcaaccgctcgtttcaatggaaaca
gctaaagctgtagttgatgttccttgtcctcagagtggaaaaatcgttaagctcttcggt
aaccctggcgatgtaatcaaaacaggagagcctttagttggctttgaagcagcggctgag
tctgacaagaaagtcgataagggcacagttgtgggcaatcttgaagaaagcaccgatatc
agtgaagacaatttcatcattggttctagcagaaaaaattcgcaacgcatcaaaacaact
ccggctgttcgcttattggcaaaaaaattaggtgttgacctcaattcactaatgggcagt
ggcgggcacggcgtaattacccttgaggatgtgcaagctgccgcagagaaaaaagcgcag
ttgccagaagggtatgaagcactacgtggtgtaagaagggctatgcttaacagtatggtt
caatcgcatcaagaaatagttcctgttagtatttttgatgaagctgacatcgaatgctgg
ccagcaggaaccgatattactgtgcgtttaattcgtgccattatacacgcctcaaaacaa
gaacctgcacttaatgcttggttcgacacagcccacagtgcacgcaaatgttttagcgaa
gtgcatttaggtatcgcaatggacagtagtgaaggtttgtttgttcctgttatccataat
gcagccacccattctgacgagcaactacggaagattattgatgactataaacaagcagtc
tcggaacgtgttgtagcaccagagaaattaaaaggggcaaccattactttatctaatttt
ggtaaatttgctggccgttttgcaagcccgattattgtaccccccatggtagccattctt
gcagttggccgattataccaaggcgtggtagcacttaacggtaaagtggaaacccatcgt
ctactaccactttccttaagctttgatcatcgtgcggttactgggggtgaagcaacacgt
tttttaggcgcggtaattgaagctttacaaaaacctgaaataatgtaa

DBGET integrated database retrieval system