KEGG   Tatlockia micdadei: LMI_1553Help
Entry
LMI_1553          CDS       T03810                                 

Gene name
alh
Definition
(GenBank) putative aldehyde dehydrogenase family 7 member A1 homolog
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
tmc  Tatlockia micdadei
Pathway
tmc00010  Glycolysis / Gluconeogenesis
tmc00053  Ascorbate and aldarate metabolism
tmc00071  Fatty acid degradation
tmc00280  Valine, leucine and isoleucine degradation
tmc00310  Lysine degradation
tmc00330  Arginine and proline metabolism
tmc00340  Histidine metabolism
tmc00380  Tryptophan metabolism
tmc00410  beta-Alanine metabolism
tmc00561  Glycerolipid metabolism
tmc00620  Pyruvate metabolism
tmc00625  Chloroalkane and chloroalkene degradation
tmc00903  Limonene and pinene degradation
tmc01100  Metabolic pathways
tmc01110  Biosynthesis of secondary metabolites
tmc01120  Microbial metabolism in diverse environments
tmc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMI_1553 (alh)
   00053 Ascorbate and aldarate metabolism
    LMI_1553 (alh)
   00620 Pyruvate metabolism
    LMI_1553 (alh)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LMI_1553 (alh)
   00561 Glycerolipid metabolism
    LMI_1553 (alh)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LMI_1553 (alh)
   00310 Lysine degradation
    LMI_1553 (alh)
   00330 Arginine and proline metabolism
    LMI_1553 (alh)
   00340 Histidine metabolism
    LMI_1553 (alh)
   00380 Tryptophan metabolism
    LMI_1553 (alh)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LMI_1553 (alh)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LMI_1553 (alh)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LMI_1553 (alh)
Enzymes [BR:tmc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     LMI_1553 (alh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC ETF
Motif
Other DBs
NCBI-ProteinID: CEG60855
UniProt: A0A098GFU2
Position
I:1639611..1641131
Genome map
AA seq 506 aa AA seqDB search
MDLLKRLNISEINPGAFSGYGWHSETGSNRLVSVNPANGEKLAEIATCSMQDYQHILECA
QQAALAWKQVPAPKRGEIIRQIGEALREHKDALGSLVSLEMGKSKQEGDGEVQEMIDIAD
FAVGQSRMLYGNTMHSERPNHRMYEQWHPYGIVGVISAFNFPVAVWSWNAFIAAICGNVT
LWKPSAKTPLCAIAVQHICNQVLQKNNSPEIFPLIIPSSHDIANEMVNDSRIPLISFTGS
TAVGRQIAAKVAARLGKTILELGGNNAIILDESADLNLAIPAIVFGAVGTAGQRCTSTRR
LFVHENMYRNVIERLRHAYEQITIGDPLDSKNLMGPLIDQQAVTQFKNAVTRIKDAGGQI
VFGGQVINRPGYFVQPTLVTEIKNEWEIVQEETFAPILYVMPYRTLEEAVNLQNGVPQGL
SSAMFTQNLKSAEYFLSALGSDCGIANINIGTSGAEIGGAFGGEKETGGGRESGSDSWKA
YMRRQTNTINWGNELPLAQGIRFNLS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggatttattaaagcgtctgaatattagtgaaattaatccgggtgcattcagcggatat
ggctggcatagcgaaacgggctcaaaccgcttagtttcagttaacccagccaatggggaa
aaactcgctgagatagctacctgctcaatgcaagattatcagcacattttagaatgtgcc
cagcaagctgctttagcatggaagcaagtgcccgcgcccaaacgtggtgaaattatccgt
caaattggcgaagcgttgcgtgaacataaagatgcattgggtagcttagtttccttggaa
atgggtaaatcaaagcaagagggtgatggtgaagtccaagaaatgatcgacattgctgat
tttgccgtaggacaatcccgtatgctttatggtaataccatgcattctgagcggcctaat
catcgtatgtatgagcaatggcatccttatggaatcgtgggagttatctctgcatttaat
ttcccagtcgctgtttggtcatggaatgcatttattgctgctatttgtggcaatgtcact
ttatggaagccttctgccaagacaccactctgtgcaatcgctgtccaacatatttgtaac
caagtgctgcaaaaaaacaatagcccggaaattttccctctgattattccaagttcccat
gacattgcgaatgagatggtcaatgattcacgtattccgttgatttcatttacaggatca
acagcagtgggcaggcaaatagctgccaaagtagccgcccgccttggcaagactatcctg
gagttaggcggaaataacgcaattatcctagatgaatccgctgatttgaatctggcaatt
ccagcaattgtattcggtgcagtgggaactgcaggtcaacggtgtacgtcaacgcgtcgg
ttgtttgtgcatgaaaacatgtatcgcaacgtgattgaacgattgcgacatgcttatgag
caaatcaccattggggatccgttggacagtaaaaatttaatggggcctttgattgatcag
caggcagtgacccagtttaaaaatgccgttacccgtattaaagacgcaggtggacaaatt
gtgtttggcgggcaagtaataaataggcctggatattttgtccagccaaccttagtaaca
gaaataaaaaatgaatgggaaatcgtgcaagaagaaacttttgcgcctatcctctatgtg
atgccttaccgtacactagaagaagccgttaaccttcaaaacggagttcctcaagggtta
tcttctgctatgtttactcaaaatcttaagagtgcggaatatttcttaagtgctttaggt
agtgattgcgggatcgccaatatcaatatcggcacttctggagcagaaataggcggtgca
tttggtggtgaaaaagagacgggcgggggccgtgagtcaggatccgattcgtggaaagcc
tacatgcgccgccaaacaaataccatcaattggggaaatgagttaccacttgcccaaggt
atacgttttaatttgtcatag

DBGET integrated database retrieval system