KEGG   Tatlockia micdadei: LMI_1621Help
Entry
LMI_1621          CDS       T03810                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tmc  Tatlockia micdadei
Pathway
tmc00071  Fatty acid degradation
tmc00072  Synthesis and degradation of ketone bodies
tmc00280  Valine, leucine and isoleucine degradation
tmc00310  Lysine degradation
tmc00362  Benzoate degradation
tmc00380  Tryptophan metabolism
tmc00620  Pyruvate metabolism
tmc00630  Glyoxylate and dicarboxylate metabolism
tmc00640  Propanoate metabolism
tmc00650  Butanoate metabolism
tmc00900  Terpenoid backbone biosynthesis
tmc01100  Metabolic pathways
tmc01110  Biosynthesis of secondary metabolites
tmc01120  Microbial metabolism in diverse environments
tmc01130  Biosynthesis of antibiotics
tmc01200  Carbon metabolism
tmc01212  Fatty acid metabolism
tmc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMI_1621 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    LMI_1621 (thlA)
   00640 Propanoate metabolism
    LMI_1621 (thlA)
   00650 Butanoate metabolism
    LMI_1621 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LMI_1621 (thlA)
   00072 Synthesis and degradation of ketone bodies
    LMI_1621 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LMI_1621 (thlA)
   00310 Lysine degradation
    LMI_1621 (thlA)
   00380 Tryptophan metabolism
    LMI_1621 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMI_1621 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LMI_1621 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LMI_1621 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tmc04147]
    LMI_1621 (thlA)
Enzymes [BR:tmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LMI_1621 (thlA)
Exosome [BR:tmc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMI_1621 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt DUF1804
Motif
Other DBs
NCBI-ProteinID: CEG60920
UniProt: A0A098GG10
Position
I:1719992..1721185
Genome map
AA seq 397 aa AA seqDB search
MTTDIFICSPTRTAIGTFNGTLKNTSAPQLGAAVIKETLRRAKLSPDKVEAVVMGQVVQA
GAGMNPARQAAVHGGIPVDVPAYTVNRVCGSGAQAIVSAYLEVVSGNIHCAIAGGMENMD
LCPYLLTSARWGYRMGDSKIIDSMLLDGLHDVFSGNHSGWHTEDLAEKYSISRNEQDSWA
LRSQQRFSKAQAEGKFDAEITPIEISNRKGTELFQKDEHNRPDTTAETLAKLKPAFRKEG
TITAGNAPGLNSGAVAMIIADADFISSHHLKPMARIVAYGVGAVEPGMFGIGPVSAVLQA
LQRAKWKLPDIQRVEINEAFAAIAIAVTREIGFNEEIVNVEGGAIAHGHPIGATGAILTT
RLLYSMKRDGLKRGMVTLCIGGGQGIALALEICNENT
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgacattttcatttgttcgccaacgcgtacagctattggaacctttaatggt
acgttgaaaaacacatctgctcctcaactgggtgcagctgttatcaaggaaacgcttagg
cgtgcgaaactttcaccagacaaagtagaagcagtcgtaatgggtcaggttgtccaggct
ggagcaggcatgaatccagctcgtcaagcagctgtccatggaggaattcctgttgatgta
cctgcttacacagtgaatcgggtgtgcggttcaggtgctcaagctattgtctctgcttat
ttagaagtcgtcagcggcaatatccattgtgcaattgccggaggcatggaaaacatggat
ctttgtccttatcttctaacctcagcacgctggggatatcggatgggcgatagcaagatc
attgatagcatgctattggatggtttgcatgatgtgttctcaggaaatcattcgggttgg
catactgaagatcttgcagaaaaatattcgatttcccgcaatgaacaggattcatgggca
ctgcgctctcaacaacgtttttccaaggcgcaagcagagggtaaatttgatgctgaaatt
actcccatagaaatcagtaatcgtaaaggaaccgaattattccaaaaagatgaacataat
cgtcctgatacaactgcagaaacccttgcgaaactaaaaccagcttttcgcaaagaaggc
actattacggcaggtaatgcgccaggattgaacagtggtgcagtcgctatgattattgcg
gatgccgattttatttcctcgcatcaccttaagccaatggcccgcatcgtagcctatgga
gtcggtgctgttgaaccaggtatgtttggcatcggcccggtttctgctgttttgcaggca
ttgcaacgagcaaaatggaaattgcctgacattcagcgagtggaaattaatgaagcgttt
gcagcaattgctatcgcagtgacgcgtgagattggattcaatgaagaaattgtcaatgtc
gaaggtggggctattgcccatggccatcctattggtgcaactggtgccattttaactaca
cgcttattgtattcgatgaaacgtgacggattaaaacgcggcatggttacattatgcatt
ggcggtggccaagggattgctctggccctagagatctgcaatgagaatacgtga

DBGET integrated database retrieval system