KEGG   Tatlockia micdadei: LMI_2996Help
Entry
LMI_2996          CDS       T03810                                 

Gene name
gcvT
Definition
(GenBank) Aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
tmc  Tatlockia micdadei
Pathway
tmc00260  Glycine, serine and threonine metabolism
tmc00630  Glyoxylate and dicarboxylate metabolism
tmc00670  One carbon pool by folate
tmc01100  Metabolic pathways
tmc01110  Biosynthesis of secondary metabolites
tmc01130  Biosynthesis of antibiotics
tmc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LMI_2996 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMI_2996 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LMI_2996 (gcvT)
Enzymes [BR:tmc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     LMI_2996 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD
Motif
Other DBs
NCBI-ProteinID: CEG62226
UniProt: A0A098GL58
Position
I:3111318..3112616
Genome map
AA seq 432 aa AA seqDB search
MKCQDYSNSKYCGRLQSKKQNIFLSLLMILLEAIFRQNTFGQTEGKRYVLSLVVMPHLGI
IICTNARKKGVAMIAKTPLHASHVALGAKMVDFHGWEMPLHYGSQLEEHHSVRQHAGMFD
VSHMTIVDVLGAGGRQFLRKLLTNDVDLLEHTGRALYSCMCNEHGGIIDDLIAYQRASDN
YRIVLNSATRARDLAWIRSKSEGFAVGLQERNELAMLAVQGPEAIAKTMSLLTPAQTDAV
STLTNFECVDIDSWFFARTGYTGEDGLEIILPKEEITRLWSSLLEAGVKPCGLAARDTLR
LEAGMLLYGQDMDESTTPLESGLEWTVKWQPEERDFIGMGALLSQKQQGVKRKFVGLILQ
DKGVMRSGQRVIVEGHADGVITSGTYSPTLAKSIALARVPAKTGEQVMVDIRGKLIPAKV
VKPRFVKRGQIL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgtcaagactacagtaattcaaaatattgtggaaggttgcagtccaaaaaacaa
aacatcttcctatcattattaatgattttgctagaagcaatttttagacaaaacacattt
ggacagactgaaggtaaaagatatgttttatctcttgtcgtaatgcctcatctcggtata
atcatctgcaccaacgcgcgaaaaaagggagtcgcaatgatcgcaaaaacaccactccat
gctagccacgtggcattgggtgccaaaatggtagattttcatggctgggaaatgcctctg
cactatggctcacagttggaggagcatcacagtgttcgccaacatgctggaatgttcgat
gtctcgcacatgactatcgttgatgtccttggcgcaggcggcaggcaatttttacgtaaa
ttattaactaatgatgttgatttgcttgagcacaccggacgcgcgctttatagctgcatg
tgcaatgaacacggtggaatcatcgacgatttaatcgcttaccaacgtgcctcggacaat
tatcgtatcgttttaaattccgctacacgcgcacgtgacctagcctggattcgcagcaaa
agcgagggatttgcagttggattacaagagcgcaatgagcttgccatgctggcggtacaa
ggacctgaagcaatagcaaaaacaatgagtcttcttactcctgctcaaactgatgcagtc
tcgacactcactaattttgagtgcgtggatattgacagctggttttttgctcgtactggc
tataccggcgaagatgggctagaaattatcctccctaaagaagaaattactcgattatgg
tcctccttattggaggcaggagtaaaaccatgtggcttagcggcccgggatacccttcgt
ttggaagcaggtatgctgttgtatgggcaagacatggatgaatcaaccacccccttggaa
tccgggttagaatggaccgtaaaatggcaaccagaagaaagggactttattggcatgggc
gccctcctgtctcaaaaacagcaaggtgtaaaacgtaagtttgtaggcctaattttacaa
gacaaaggtgttatgcgcagcggacaacgtgtgattgttgaaggccatgcagatggggtc
ataaccagcggaacctattcccccactctcgctaaatcaatcgcgttagcacgggtacct
gctaaaacaggagaacaggtaatggtggatattcgcggaaaactcattccggctaaagtg
gttaaacctaggtttgttaagcgcggacaaattttataa

DBGET integrated database retrieval system