KEGG   Thermosipho melanesiensis: Tmel_0234Help
Entry
Tmel_0234         CDS       T00550                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
tme  Thermosipho melanesiensis
Pathway
tme00471  D-Glutamine and D-glutamate metabolism
tme00550  Peptidoglycan biosynthesis
tme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tme00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Tmel_0234
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tmel_0234
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tme01011]
    Tmel_0234
Enzymes [BR:tme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Tmel_0234
Peptidoglycan biosynthesis and degradation proteins [BR:tme01011]
 Precursor biosynthesis
  Amino acid ligase
   Tmel_0234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ABR30108
UniProt: A6LJK7
Position
complement(238454..239734)
Genome map
AA seq 426 aa AA seqDB search
MKFTLLGFGLSNKEIFKYLVKNGHEVFVSEGKKLASSDKKLLLENGVQFEENGHTEKALE
CDIILVSPGVHFENEIIKEAKRRSIEIDTEISFCQREFEKIGWTPFVIAVTGSVGKSTTV
SLIYHLLNKKVRALLAGNIGIPIAKLLNDNLRANYLVLEISSFQLFWSKRFKPNISSILN
IYPNHLNWHPDMEHYVSSKFKIASFQSKDDVFVYNPNDEYIRKNLYKVSAKKVPFRFDFS
IEKLPIHLRYRQTVENVAAAKTILETMGYEFKWEFLEDFEKLPHRMEYVTEINGVKFFND
SKATNAIAVIRAIENFDDKLHLIMAGIGKNEDYTLLAKIIKEKVKILALVGPIADEIEPY
LDGVRYFKVDTINQAVNQLFSMASRGDVIMLSPGGASFDAFKNFEERGEYFKQLVMQLKE
GNCEEC
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtttactttgttgggttttggattaagtaacaaagaaatttttaaatatcttgtg
aaaaatgggcatgaagtttttgtaagtgaggggaaaaaattagcttcttctgataaaaag
ttgttattggaaaatggtgtgcaatttgaagaaaatggacatacggaaaaagcacttgaa
tgtgatattattttggttagtcccggtgtacattttgaaaatgaaataataaaagaggcg
aaaagacggagtattgagatagatacggagatctccttttgtcagagagaatttgaaaaa
atcggttggactccttttgttatagcagttacaggttctgtggggaagagcactactgtg
tctttaatttatcatttgttaaataaaaaagtaagggcattactagcaggaaatattggg
attccaattgcaaaacttttaaacgataatttaagggcaaattatttggttttagagata
agtagttttcagttgttttggtcaaaaaggtttaaaccaaatatttcttcgattttgaat
atatatcctaatcatctaaattggcatcctgatatggagcattatgtttcttcaaaattt
aaaattgcatcttttcaaagtaaagatgatgtttttgtatacaatccaaacgatgagtat
ataagaaagaatttatataaagtaagtgccaagaaagtaccatttagattcgacttttca
attgaaaaattacctatacatcttagatataggcaaacagtagaaaatgtggctgctgca
aagactattttggaaaccatgggttatgaatttaaatgggagtttttggaagattttgaa
aaattaccgcacagaatggagtatgttacggaaataaacggagtgaaatttttcaacgat
tctaaagctacaaatgcaattgccgtaatccgtgctattgaaaattttgatgataaatta
catttaataatggcgggaataggtaagaatgaagattatacattacttgcaaagataatt
aaagaaaaggtaaagattttggcattagtaggtccaatagcagatgagatagagccttat
cttgatggtgttagatattttaaagttgatacgataaatcaagcggtaaatcaattgttt
tcaatggcttctagaggggatgttattatgctgagtccaggtggtgcaagttttgatgcg
tttaaaaattttgaagaacgtggagaatattttaagcaacttgttatgcaattaaaggag
ggaaattgtgaagaatgttag

DBGET integrated database retrieval system