KEGG   Thermosipho melanesiensis: Tmel_0908
Entry
Tmel_0908         CDS       T00550                                 

Definition
(GenBank) hypothetical protein
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
tme  Thermosipho melanesiensis
Pathway
tme00472  D-Arginine and D-ornithine metabolism
tme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tme00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Tmel_0908
Enzymes [BR:tme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Tmel_0908
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A RNR_Alpha
Other DBs
NCBI-ProteinID: ABR30769
UniProt: A6LLG8
Position
945660..946034
AA seq 124 aa
MNPRKDDFKERSKHLQKMSDEELNEYFWHLVERVVDPLIELARTHTSPSVERSVLLRMGF
NSLESSKLVDLIFQRGLLGKGAGHIVWRIAKEKNLDIIEAGRALIEGRYWEDVDRIFKGV
GNNA
NT seq 375 nt   +upstreamnt  +downstreamnt
ttgaaccccagaaaggacgattttaaagaaagaagtaagcatcttcagaaaatgagtgat
gaggagctaaacgaatatttttggcatcttgtagaaagggttgtagatcctttaatagaa
ttggcaagaacacatacttctccttcagttgaaagatcagtattacttagaatgggattt
aatagtttagaatcctctaaacttgttgatttgatatttcaaagaggcttgttgggaaaa
ggagcaggtcatattgtttggagaatagcaaaggagaaaaatttggatattattgaagca
gggagagcgttaatagaaggaagatattgggaagatgtagatagaattttcaaaggggtg
ggaaacaatgcttga

DBGET integrated database retrieval system