KEGG   Thermosipho melanesiensis: Tmel_0909
Entry
Tmel_0909         CDS       T00550                                 

Definition
(GenBank) cobalamin B12-binding domain protein
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
tme  Thermosipho melanesiensis
Pathway
tme00472  D-Arginine and D-ornithine metabolism
tme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tme00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Tmel_0909
Enzymes [BR:tme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Tmel_0909
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: ABR30770
UniProt: A6LLG9
Position
946027..948213
AA seq 728 aa
MLDPKKPIDIDEILKDLDKYRPKRKGWTWRKRLPEETKIGDYKYYQVSEDLKNSIPLPAA
HYFGGIDPQPEVVITSEIASGRFEDDIRRMRMAAWHGADHIMVIRTLGQSHYDGLIEGTP
EGIGGIPITRKQLRATRKALDLIEEEVGRPINFHSYVSGVAGPEIAVLFAEEGVNGAHQD
PQYNVLYRGINPIRSFVDAAVAKKIMASVNMLQIDGAHNANASAKLAWTVMPELLVQHGI
NCMYSLKAGMKKEYIALSTVPPVVAPMPEFRYNLPYAVALRELFDGFRFRAQMNTRYIES
DLFDATRIHVLNTLISRLTSADLQSTITPDEGRNVPWHVNSIRGVETAKHTLVALDGMKR
YVKIDEKEIGLKVRELKMRAILMLEEILDIGGYFEALEAGMFVDNGYYPERIGDGIARKK
NGEIAAGTVVPRDEDYMAPVCEHFGYNNLPEGIEKPCDLIGGCTLHNPDKIQFIDELDES
DNVNIRLEKIRDMRKRNVIKPEVEWFSDGWIQMDMTFALPEELAEAAAIALCQKLGLEEP
TVIHKTILHPSEGTYIEVKAKVPFEIEIDKLELPKKPETLPEEEIFEFIQKNPIHVVAGT
VGNDEHSVGLREVLDIKHGGIEKYGIKYTYLGTSVPPEKLIDAAIETGAKVILASMIITH
NDVHIQNMKKLHELAIEKGIRDKVLIIAGGTQINNDLAVENGMDAGFGRGTKGIHVASFI
VKKLKEKK
NT seq 2187 nt   +upstreamnt  +downstreamnt
atgcttgatcccaagaaaccaatagatatagatgaaattttaaaagatttggataaatat
aggccaaagagaaaaggttggacttggcgaaaaagattgccggaagaaacaaaaataggt
gattacaaatattatcaagtaagtgaagatttgaagaattccataccacttccagcggcc
cattatttcggtggcatagatccacaaccagaggttgttataacttctgaaatagcatct
gggagatttgaagatgatataagaaggatgagaatggcagcatggcatggtgcagatcac
ataatggttataagaactttggggcaatcacattacgatgggctaattgagggtacacct
gagggaataggtggtataccaattaccagaaaacaactccgtgcaacaagaaaggctttg
gatttaatagaagaagaagtaggaaggccaataaattttcatagttatgtttctggagtt
gcaggtcctgaaattgcagttttgtttgcagaagaaggggtaaatggtgcacaccaagac
ccacaatacaatgttttgtatagaggtatcaatccaatacgttcatttgtcgatgccgct
gttgcgaaaaagattatggcatctgtaaatatgttacagatagatggggctcataacgcc
aatgcatctgcaaagttagcatggacggtaatgccagaacttttggtacaacacggtatt
aattgtatgtattcattaaaagcaggaatgaagaaagagtatatagcactttccacagtt
ccaccagttgttgcaccaatgcctgaatttagatataacctaccgtatgcagttgctttg
agagaattgttcgatggatttagatttagggcacaaatgaatacaagatatatcgagtca
gatttattcgatgctacaagaatacacgttctcaacacgttgatttcacgactaacatct
gcagatttgcaatcgacaattactcctgacgaaggaagaaatgtaccatggcatgtaaat
tccatacgtggtgttgaaactgcaaaacacacattagttgcactagatggaatgaaaaga
tatgtgaagatagacgaaaaagaaattgggttaaaagtaagagaattgaaaatgagagca
attttaatgcttgaagaaatattagatataggtggttattttgaggcgttggaagcggga
atgtttgttgataatggttattatcccgagagaataggtgatggaattgcaaggaaaaag
aatggtgaaatagcagcgggaacagttgttcctagagatgaagattacatggcaccagtg
tgtgagcattttggatataataatttgcctgagggaattgaaaaaccttgcgatttgata
ggaggctgtacattacacaatccagataaaatacagtttatagacgaattggatgaaagt
gataacgtaaatattaggctggaaaagataagagatatgagaaaaagaaatgttataaaa
ccagaagtagaatggttctcggatggatggatccaaatggatatgacgtttgcgctccca
gaagagttggctgaggcagccgcaatagctttatgtcaaaagttaggtcttgaagagcct
acggtaattcacaaaacaatacttcatccatcggaaggaacgtatatagaagttaaagca
aaggtaccttttgaaatagagatagacaaattagaacttccaaagaaacctgaaacatta
cccgaagaggaaatatttgagtttatccaaaaaaatccgatacacgtagttgcaggaaca
gtagggaatgatgaacattcagttggattaagagaagtattggatataaaacatggtggt
attgaaaagtatgggataaaatacacataccttggaacaagtgttccacctgaaaaactt
attgatgcagctattgaaacaggtgcaaaggtaattcttgcatctatgataattacacac
aatgatgttcatattcagaatatgaaaaaattgcatgaacttgcaattgaaaaaggaata
agagataaggtattgattatagcaggtggtactcaaattaataatgaccttgctgttgaa
aatggtatggatgcagggtttggacgtggaactaaaggaattcatgttgcctcgtttata
gtcaaaaaattaaaagaaaaaaaataa

DBGET integrated database retrieval system