KEGG   Thermosipho melanesiensis: Tmel_1759Help
Entry
Tmel_1759         CDS       T00550                                 

Definition
(GenBank) small GTP-binding protein
  KO
K03665  GTPase
Organism
tme  Thermosipho melanesiensis
Brite
KEGG Orthology (KO) [BR:tme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:tme03009]
    Tmel_1759
Ribosome biogenesis [BR:tme03009]
 Prokaryotic Type
  GTPases
   Tmel_1759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP-bdg_M GTP-bdg_N MMR_HSR1 Arf MMR_HSR1_Xtn GTP_EFTU Roc Ras ABC_tran MobB Dynamin_N PduV-EutP CCDC-167 FeoB_N AAA_18
Motif
Other DBs
NCBI-ProteinID: ABR31598
UniProt: A6LNU7
Position
complement(1747336..1748421)
Genome map
AA seq 361 aa AA seqDB search
MKKNKQVLIAGIYKKFVDESFYELEQLCKTLGWNVFDKIFQKRRTPDARFYFGKGLLLKI
KELIEKGEIDYLVIDDDITNIQRRNIETILYKKVYDRTEVILEIFSKHAKTKEGRIQVEI
ARLRYLMPYLVGKGKELSRLGGGIGTRGPGEKKLEYEKRYLKRRISTLQNKLKMIKRNRD
IQRKKRLNSNLLKISIVGYTNAGKTTLLSKLSKQNLYSKDEMFTTLAPTSRKVMLPSGKF
AVFSDTVGFIRKMHPLIIEAFLSTLEEIIYSDLALVVVDVSDVSFREKIKVIYETLEKIG
VNLGRTKLVFNKIDLCNSNYLKNLENEFKDAIFISAKKKVNFDYLLNEIDKVRLKEVSIK
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaataagcaagttttaattgcaggaatttataaaaagtttgttgatgaatcg
ttttatgaattagaacaattatgtaaaactttaggctggaacgtttttgataaaatattt
caaaaaagacggactcctgatgcaagattttactttgggaaaggtttattactaaaaata
aaagagttaattgaaaaaggtgaaatagattacttagtaattgatgatgatattacaaat
attcagaggcgaaatatagaaacgattttatataaaaaagtttatgatagaactgaggta
atcttggagattttttctaaacatgcaaagacaaaagaaggtagaatacaagttgaaatc
gcaagattgcgatatttgatgccatatttggtaggaaaaggtaaagagttatcaaggctt
ggtggtggaattggcactagaggacctggggaaaaaaagttggagtatgaaaaaagatat
ttgaaaagaagaataagtactttacaaaataagttaaaaatgataaaaaggaatagagat
attcagaggaaaaagcggttaaattcaaatttacttaaaatttcaattgttggttataca
aatgcaggaaaaactactttattatctaaattgtcaaagcaaaatttatattcaaaagat
gaaatgtttacaacgttagcaccaacaagcagaaaagtaatgttgccatctggtaagttt
gcggtgttctccgatacagtagggtttattcgaaaaatgcatccgttgataattgaggca
tttttatctactttagaagaaataatttattctgatttagctttggttgttgtagatgta
tcggatgtgagttttagagaaaaaataaaagttatttatgaaactcttgaaaaaattggc
gtaaatttaggtagaacaaaattggtttttaacaagattgatctttgtaattcaaattat
ttgaaaaatttagaaaacgagtttaaagatgcaatttttatttctgcaaagaagaaagta
aactttgattatttactaaatgaaattgacaaagttagacttaaggaggtaagtataaag
aaatga

DBGET integrated database retrieval system