KEGG   Thermosipho melanesiensis: Tmel_1861Help
Entry
Tmel_1861         CDS       T00550                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tme  Thermosipho melanesiensis
Pathway
tme00051  Fructose and mannose metabolism
tme01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tme00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Tmel_1861
Enzymes [BR:tme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Tmel_1861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II Ub-RnfH
Motif
Other DBs
NCBI-ProteinID: ABR31695
UniProt: A6LP44
Position
complement(1847073..1847711)
Genome map
AA seq 212 aa AA seqDB search
MKKEILRAVKFIVDNNLVKGTWGNVSIREGNIIYITPSGVPYDKLKEGMISVVDFNGNLV
EGLKPSSELPTHIEIYKSRKDVRAIVHTHPVFSSTISVVSSEIPPIIEDAVMILGPEIKV
SEYALPGTWELAKNVVDALSDNHAVILKNHGLITVGTNIDEALTASLICEKTAEIYLYAL
NIGNFSTISNEDAVMLRNKYLNSYRHMGKDVR
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagagatattgagagcggtaaaatttatagttgataacaacttggtaaaggga
acctgggggaatgtttcaataagagaaggaaatattatttatattactccttcaggtgtt
ccttatgataagttaaaagaaggtatgataagtgtagtagattttaatgggaatttagta
gagggattaaaaccttcatcagaacttccaacgcatattgagatttacaaatcaagaaaa
gatgtaagggcaatagttcatacacatccagtgttttcgtcaacaatttccgttgtttca
agtgagataccacctataattgaggatgcagttatgattttaggaccggaaataaaggtg
tctgaatatgcattgccaggtacttgggaacttgcaaaaaatgttgttgatgcgctttct
gataatcatgctgttatactaaagaatcatggtttaattaccgtgggaacaaatattgat
gaggcgttaactgcaagtttaatttgtgaaaagactgccgaaatatatttatatgcctta
aatattggaaatttttcaacaattagtaatgaggacgcggttatgcttagaaataagtat
ttaaatagttatagacatatggggaaagatgtaagataa

DBGET integrated database retrieval system