KEGG   Talaromyces marneffei: PMAA_024520
Entry
PMAA_024520       CDS       T06392                                 

Definition
(RefSeq) c-14 sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
tmf  Talaromyces marneffei
Pathway
tmf00100  Steroid biosynthesis
tmf01100  Metabolic pathways
tmf01110  Biosynthesis of secondary metabolites
Module
tmf_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:tmf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    PMAA_024520
Enzymes [BR:tmf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     PMAA_024520
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 7021907
NCBI-ProteinID: XP_002144096
UniProt: B6Q6F5
Position
Unknown
AA seq 497 aa
MGPKKGPKATVPVQIVPEKRGYEFGGPLGAAGIVFGLPVLIYCFAFFCNDISGCPAPSLL
HPSTLTWDKLKYEIGWPENGIASLYDTEVTLWILSYYALLLFLQIFLPGQEVEGVELACG
GRHKYKFNTFRSTILILGGLAAGTYVYGAEFAVWTFLWDKYVQVITANLLITIVISIYVY
ARSFSIPEPGQPNPDLRELAPGGHTGNVIYDFFIGRELNSRVILPIPFVSETARTIDIGV
FCEMRPGLIGYIILNLSNVVHQYRTHGYVTDSILLITIAQAFYILDSSYMEPAILTTMDI
IMDGFGYMLCFGDLVWVPFLYSTQTRYLAMFPVKMGLEGIALSVAVVGLGYYIFRSANNE
KNRFRTDPNDPRVKHLKYMETKTGSKLLISGWWGTARHINYLGDWLMSWGYCLPTGFAGY
TIIEAINSTTGELEKHAVQTPESRGWGTIFTYFYILYFGILLIHREGRDEEKCHRKYGKD
WDKYTSLVRSKIIPGIY
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgggcccaaagaaaggacccaaagctactgtacctgtacaaattgtcccggagaaaagg
ggctatgaattcgggggaccactaggcgctgcaggaattgttttcggcctgcctgtcctc
atctactgctttgccttcttctgcaacgacatctccggctgtccagcgccgtctctcctt
cacccctcgacgttgacctgggataaattgaagtatgaaattggttggcctgagaatggt
attgccagtctttacgatacagaggtgacgctgtggattttgtcttattatgcccttctc
ctctttttgcagattttcctgcccggacaggaagtggagggtgttgaattggcgtgcggt
ggacgacacaagtacaaattcaacacgttccgctccaccatcttgattctaggaggtctt
gcggctggaacgtatgtttacggagccgagttcgctgtctggactttcctttgggataag
tacgtgcaggtgattacggcaaatctcctcatcacgattgtgatctcaatttatgtatac
gcgcgaagcttctccatcccggagcctggacaaccaaaccccgaccttcgtgaactggct
ccaggtggccataccggcaatgtcatctatgacttcttcattggacgggaactcaactct
cgcgtgattttgcctatccctttcgtcagtgaaacagcccggacaattgatatcggtgtc
ttttgcgagatgagacccggtctgattggctacatcattctcaatctgtcgaatgttgta
caccagtaccgtacccatggctacgtcactgattcgattctcttgattactattgcgcaa
gctttctatattctggatagttcgtacatggaacctgccattcttaccaccatggacatc
atcatggatggcttcggttacatgctctgcttcggtgacctagtatgggttccatttctg
tactcgacccagacaagatatctcgcaatgttcccggtgaagatgggtcttgagggcatt
gcactctccgtcgctgtcgttggcctcggatactatatcttccgtagcgcaaacaacgag
aagaaccgcttccgaacagaccctaacgacccacgcgtcaaacacctcaaatacatggaa
acaaagactggatctaaattactcatttccggatggtggggaactgcgcgtcatatcaac
tacctcggtgactggcttatgtcctggggttattgcctacctaccgggttcgcgggttac
accatcatcgaggccattaactcgactacgggagaattggagaagcacgctgtacagaca
cctgaatctcgaggttggggtacaatctttacttatttctatattttgtattttggcatc
cttctcattcatcgcgagggcagagatgaggagaagtgtcatcgtaagtatggaaaggat
tgggacaagtatacttcgttggtgcgaagcaagattattccgggtatttactag

DBGET integrated database retrieval system