KEGG   Talaromyces marneffei: PMAA_068100
Entry
PMAA_068100       CDS       T06392                                 

Definition
(RefSeq) nitrite reductase NiiA
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
tmf  Talaromyces marneffei
Pathway
tmf00910  Nitrogen metabolism
tmf01100  Metabolic pathways
Module
tmf_M00531  Assimilatory nitrate reduction, nitrate => ammonia
tmf_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:tmf00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    PMAA_068100
Enzymes [BR:tmf01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     PMAA_068100
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Rieske_2 Rieske Fer2_BFD NIR_SIR_ferr Rubredoxin_C
Other DBs
NCBI-GeneID: 7023946
NCBI-ProteinID: XP_002146261
UniProt: B6QCR0
Position
Unknown
AA seq 1097 aa
MAPLMHEDPSIEGVIAGIGSHHESAVQTVSSRKKIVIVGLGMVAISFIEKIMKWDAEQRQ
YDIVVIGEEQHLAYNRVGLSTFFEHRKIEDLYLNSQEWYSSFTDGSFNYHLNTLVTEIDA
TKKQVQTSAGNWISYDLLILATGSDAVLPESTPGYDAKGIFVYRTIDDLERLIEFASHHK
GETGVTVGGGLLGLEAAKAMTDLEDFGSVKLVDRNKYVLARQLDADAGSLVTEKIRELGL
DVMHQKKVARIETDEENNVTGITFEDGEKIDCCCICFAIGVRPRDELGAKAGIECAPRGG
FVINESLETSVSDIYAIGECASWENQTFGIIAPGIEMADVLSFNLTHRGEDPKRFHRPDL
STKLKLLGVDVASFGDFFADRDGPKFLPGRRASAEHVRPFETSEQPKISTSKVKALTYKD
PFGAVYKKYLFTMDGKYLLGGMMIGDTKDYIKLNQMVKSQKELDVPPSQFILGSQSGGEE
NADDLPDDTQICSCHNVTKGDVVESVKNGTCSTIAQIKSCTKAGTGCGGCMPLVQSIFNK
TMLEMGQEVSNHLCSHIPYSRADLYNIVAIKQLKTFEDVMKACAKNPESLGCELCKPAIG
SILSSLYNPHLMDKPVHELQDTNDRFLANIQRNGTFSVVPRVSGGEITPEKLITIGQVAK
KYNLYCKITGGQRIDMFGAKKQDLLAIWTELVEGGMESGHAYAKSLRTVKSCVGTTWCRF
GVGDSVGMAVRLEERYKSIRGPHKFKGGVSGCVRECAEAQSKDFGLIATDKGFNIFVGGN
GGAKPRHAELLAKDVPPEEVVPILDRFLIFYIRTADKLQRTARWVENLPGGLKYLQEVIL
EDKLGICADMERQMEELVGSFFCEWTETVNNPERRKYFEQFGNTEETVETIEVIKERHQN
RPAYWPKDGANEDFKGHQWSSLSWQPIIQASHFTNTKPEVSSTNVKRGDTQLAIFKIKGK
YYATQQMCPHKRAFVLSDGLIGDDDAGKYWVSCPYHKRNYDLNGEQAGRCSNDESMNIAT
FPAEEREDGWVYLKLPPTGELDSLLGTEKWKIKSTESEDPFEKVDKIYKGTRGKKIGDVK
AAAKAVSCGGGANNIDW
NT seq 3294 nt   +upstreamnt  +downstreamnt
atggcgccattgatgcatgaagatccgtcgatagaaggcgttatcgccggcattggcagt
catcatgagagtgcggtccagacggtgtctagccggaagaagattgtcattgttgggctt
ggaatggtggctatttcatttattgagaaaatcatgaaatgggacgccgagcaacgacaa
tacgatatcgtggtcattggcgaagaacaacatcttgcatataaccgagtcggattatcg
acttttttcgaacatcggaaaattgaagacttatatttaaactcacaagaatggtactct
tccttcacggatggatcatttaactatcacttaaacacactcgtcacggaaatcgacgca
acaaagaaacaagtacagacatcagccggaaactggatatcctacgatctgctcatcctc
gcaaccggttccgatgccgtgcttcccgaatccacacctggctacgacgccaagggtatt
ttcgtgtatagaacaatcgacgatttggaacgattaatcgaattcgcatcccatcacaaa
ggcgaaaccggtgtcactgttggtggtggcttacttggtcttgaagcggccaaggcgatg
accgatctagaagactttggcagtgtcaagcttgtcgataggaacaaatatgtccttgcg
cgacaactagatgctgatgctggatcactcgtgaccgagaaaatccgagagctgggcttg
gatgtaatgcatcagaagaaagtcgcacgcatcgaaacagatgaggaaaacaatgtgact
ggtatcacatttgaggatggcgagaagatcgactgttgctgtatctgttttgcaattgga
gtccgaccgcgtgatgagttgggtgccaaagcaggcattgaatgcgctcctcgaggagga
tttgtcattaatgaaagccttgaaacatctgtatcggatatttatgccattggagagtgc
gccagctgggagaatcagacattcggtatcattgctcccggtatcgaaatggcagatgta
ctttccttcaaccttacacaccgaggtgaagacccaaagaggttccaccgcccagatctg
agcaccaaactaaagctgctcggtgtcgatgtggctagttttggcgacttcttcgcagac
agggatggacccaaatttttgcctggccgacgagcttcagctgaacatgtcagacctttc
gaaacgtcggagcagccaaaaatctctaccagtaaagtcaaggcgttgacttacaaagat
ccattcggcgctgtctataagaaatatctcttcaccatggatggaaagtacctgctgggt
ggtatgatgattggtgacaccaaagactacatcaaattgaaccagatggtcaagtctcag
aaggagttggatgttcctccaagccaatttattctgggttcacagagtggcggggaagag
aatgccgacgatctgcccgatgacactcagatttgctcttgccacaacgtcaccaaaggt
gatgtggtggagagcgtaaagaatggcacttgctcaacaatcgcacaaatcaaatcctgc
accaaggctggcaccggatgcggaggttgtatgcccttagttcagtctatcttcaataaa
accatgcttgaaatgggccaagaggtttccaaccacttgtgctcccacatcccatattcc
cgcgcagacttgtataatatcgttgccattaagcaattgaagactttcgaagatgtcatg
aaggcatgcgcaaagaacccggaatctctaggctgtgaactttgcaaaccggccattggc
tcaatcctgtccagtctctacaaccctcaccttatggacaagccagttcacgagcttcaa
gacaccaacgataggttcttagccaacattcagcgcaacggaacattttccgttgtaccc
cgtgtttctggtggtgaaatcacacccgagaaacttattactatcggccaagtcgcaaag
aaatacaacctttactgtaagattactggtggtcagcgaattgacatgtttggtgccaag
aaacaagatcttcttgctatctggactgaattggtggaaggtggtatggagagtggtcac
gcttacgctaaatcactccgaacagtcaagagttgtgtcggaactacttggtgccgattc
ggtgttggtgacagtgttggtatggctgtccgtcttgaggagcggtacaagagtatccga
ggtcctcacaagttcaagggtggtgtctctggttgtgtcagagagtgtgctgaggcacaa
agcaaagacttcggtctcattgctaccgacaaaggcttcaacatcttcgttggtggtaac
ggaggtgccaagccaagacacgccgaactccttgccaaagacgtacctccagaggaggta
gtcccgattctcgaccgtttcctcatcttctacatccgcactgccgacaaactacagcgt
accgcgcgatgggtggagaatctcccgggaggtctcaagtatctacaagaggttatcttg
gaggacaagcttggcatctgcgcagatatggagcgacaaatggaggagcttgttggcagc
ttcttctgcgaatggacagaaaccgtcaacaaccccgaacgacgcaagtactttgaacaa
ttcggcaacaccgaggaaaccgtcgagacgattgaagtgattaaagaacgtcaccagaac
agacctgcatactggcccaaggatggcgcaaatgaagacttcaagggccatcaatggtcc
agcctgtcatggcagccaatcatccaagccagccatttcaccaacaccaagcccgaagta
tcatctaccaacgtcaagcggggcgacacacaattggccatcttcaagatcaagggcaaa
tactacgcaacacaacaaatgtgtcctcacaagcgcgcgtttgttctttccgatggcctg
attggtgacgacgacgccggtaaatactgggtatcctgcccttaccacaaacgcaactac
gacttgaacggcgagcaagccggtcgctgctcaaatgatgagagtatgaacattgccact
ttcccagctgaagagcgtgaggatggctgggtatacctcaagctaccccctactggagaa
ttggactctcttcttggaacggagaagtggaagatcaagagcactgagtccgaggaccct
tttgagaaggttgataagatctacaagggtaccaggggaaagaagattggtgacgtcaaa
gctgccgcgaaggcggtctcttgtggaggtggtgctaataacatcgattggtga

DBGET integrated database retrieval system