KEGG   Candidate division TM6 bacterium GW2011_GWF2_28_16: US01_C0001G0065Help
Entry
US01_C0001G0065   CDS       T04457                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
tmg  Candidate division TM6 bacterium GW2011_GWF2_28_16
Pathway
tmg00072  Synthesis and degradation of ketone bodies
tmg00280  Valine, leucine and isoleucine degradation
tmg00650  Butanoate metabolism
tmg00900  Terpenoid backbone biosynthesis
tmg01100  Metabolic pathways
tmg01110  Biosynthesis of secondary metabolites
tmg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tmg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    US01_C0001G0065
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    US01_C0001G0065
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    US01_C0001G0065
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    US01_C0001G0065
Enzymes [BR:tmg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     US01_C0001G0065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACP_syn_III_C HMG_CoA_synt_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AKM81029
UniProt: A0A0G4AZI3
Position
89681..90751
Genome map
AA seq 356 aa AA seqDB search
MKTNQVGIVAYGAAIPRHKVSTNIIAQSQGKNADVAKSLGVFSKTIPSLDEDTVTLSTEA
GKIALDRFLLNKGAVKNIETLFIGSESHPYAVKPSGTVVKEALGLSNYLSMADLQFACKA
GSQSLQIAAAYVQAKMVKNAMAIGADTAQARPGDALEYTAAAGAAAFILGHEANSDQLLA
RLSATKSVATDTPDFWRKPKESYPQHFGRFTGEPAYFKHVLMASSALLAETKLKPAEIDF
CVFHTPNAKFPEQAAKILGFTKEQLAPSLVVKEIGNTYAAASLLALTAVLDVAHASAKIL
VCSYGSGSGADAFLFETTKNLETQRVKYKKTLAAQIAALEAIDAETYQKMRTDNEH
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaatcaagtcggcatagttgcctatggtgcagctattccaagacacaaggtt
tccactaatattattgctcaaagtcagggtaaaaatgctgatgtggctaaatctttgggt
gttttttcaaaaactattccaagtttagatgaagatacagtgactctttctacagaagca
ggcaaaattgctttggatagatttttattaaataagggcgcagtcaaaaatatcgaaact
ctttttattggtagcgaaagtcatccttatgctgtcaaaccatctggcacagtagtcaaa
gaagctcttggtttaagcaactatttaagtatggctgatctacaattcgcttgcaaagct
ggttctcagtctctgcaaatcgctgcagcttatgttcaggcaaaaatggttaaaaatgcc
atggcaattggtgcagatactgcccaagctcgtcctggagatgctctagaatatactgcg
gcggcgggcgccgccgccttcatccttggtcatgaagcgaatagcgatcaattattagct
cgcttatcagccactaaatcagtagcaactgatacgccagatttttggcgcaaaccaaaa
gaatcttatccgcaacattttggcagatttactggcgagccggcttatttcaagcatgtt
ttgatggccagtagtgcgcttcttgcagaaacaaagttgaagccagcagaaattgatttc
tgcgtttttcatacgccaaatgccaagtttccagagcaagccgctaaaatacttggattt
accaaagagcaattagctccatctctagtcgttaaagaaattggtaacacttatgccgct
gcttcacttttagctctaactgcagttcttgatgtcgctcatgctagtgctaaaattttg
gtttgttcttatggttctggttcgggggctgatgcttttttgtttgaaacaactaagaat
ttggaaacacagagagtaaagtataaaaaaactctagcagcccaaattgctgctttggaa
gcaattgatgctgaaacttatcaaaaaatgaggactgacaatgaacattaa

DBGET integrated database retrieval system