KEGG   Thermotoga maritima MSB8: THEMA_00330
Entry
THEMA_00330       CDS       T02976                                 

Definition
(GenBank) preprotein translocase subunit SecF
  KO
K03074  preprotein translocase subunit SecF
Organism
tmi  Thermotoga maritima MSB8
Pathway
tmi03060  Protein export
tmi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:tmi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    THEMA_00330
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    THEMA_00330
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tmi02044]
    THEMA_00330
Secretion system [BR:tmi02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   THEMA_00330
SSDB
Motif
Pfam: SecD_SecF Sec_GG DUF2922 Sterol-sensing
Other DBs
NCBI-ProteinID: AHD17386
Position
complement(59648..60529)
AA seq 293 aa
MRKEIDFMGKSKIFITISLILIAISIVSIFTKGFNFGVEFTGGSEIIVRFENKEVTENDI
RAAISQISEEFANARIVEVRSAGDPSNVQKYSIIVPKTYEPDEKQKIQEEMEKLLSGKVV
SFNEISGTAAEEIRRGTWTAILVALVVLLIYITIRFRFIFGVAAVVALIHDVLITMGFFS
LFGYEINVAAVAAFLTLLGYSLNDTIVLSDRIRENMRRYRGRNMVNIVNMSINQVLARTI
NTSLTTFFVVFVLLLFAGNAVKPFAFGMTVGTIVGTYSSLYVASPIIVKWTKQ
NT seq 882 nt   +upstreamnt  +downstreamnt
atgaggaaagaaattgatttcatgggaaagtcgaagatcttcattacgatctcgctgata
ctgatagcgatatccatcgtttccatattcacgaaaggattcaacttcggagtggagttc
accggtggttccgagatcatagtgagatttgaaaacaaagaggtcacggaaaacgacata
agggccgctatttctcaaatctctgaagaatttgcaaacgcgagaatagtagaagttcgt
tccgcgggagatccttcaaacgttcagaagtactccattatcgttccgaaaacttacgaa
ccggatgaaaagcagaaaattcaggaagagatggaaaagctcctttcgggcaaggtggtg
tccttcaatgagatcagtggaacagcagctgaggaaatcagaaggggaacgtggacggcg
attctggtggctcttgttgtgctcctcatctacataaccatcagattcagattcatcttt
ggagtcgccgctgttgtggctctgatacacgatgtgctcatcaccatgggattcttctcg
ctgttcggctacgagataaacgtcgcggcggtggcagcgtttctcacactactcggttac
tctctcaacgacacgatcgttctttcagacaggatcagggagaacatgagaagatatcgc
ggaaggaacatggtgaacatcgtgaacatgagtataaatcaggtgctcgccagaacgata
aacacctctctcaccacgttcttcgtcgtttttgttcttcttctgtttgctggaaacgcc
gtcaaacccttcgctttcggaatgacggtgggtacgattgtgggaacgtattcctcgctt
tacgttgcctcgcctatcatcgtgaaatggacaaaacaataa

DBGET integrated database retrieval system