KEGG   Thermotoga maritima MSB8: THEMA_06145
Entry
THEMA_06145       CDS       T02976                                 

Definition
(GenBank) alkylhydroperoxidase
Organism
tmi  Thermotoga maritima MSB8
SSDB
Motif
Pfam: CMD
Other DBs
NCBI-ProteinID: AHD18483
Structure
PDB: 
1VKE 1P8C

Position
1206528..1206893
AA seq 121 aa
MEYKKFVEARRELNEKVLSRGTLNTKRFFNLDSAVYRPGKLDVKTKELMGLVASTVLRCD
DCIRYHLVRCVQEGASDEEIFEALDIALVVGGSIVIPHLRRAVGFLEELREMEKNGETIS
L
NT seq 366 nt   +upstreamnt  +downstreamnt
gtggagtacaaaaagtttgtggaagcaagaagagagctgaacgagaaggtgttatcccgt
ggaactctgaacacgaagagattcttcaatctcgactccgccgtttacaggcccgggaaa
ctcgatgtaaagaccaaagaactgatggggctcgtagcatccacggttctcaggtgcgat
gattgtataaggtaccaccttgtaaggtgtgttcaggaaggagcgagcgacgaagagatc
ttcgaagcccttgacatcgccctcgtggttggtggctctatcgtgataccgcacttgaga
agagctgtgggattccttgaagagctgagggagatggagaaaaatggcgagactatttct
ctttga

DBGET integrated database retrieval system