KEGG   Tuber melanosporum: GSTUM_00000447001Help
Entry
GSTUM_00000447001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
tml  Tuber melanosporum
Pathway
tml04113  Meiosis - yeast
tml04138  Autophagy - yeast
Module
tml_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:tml00001]
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    GSTUM_00000447001
  Cell growth and death
   04113 Meiosis - yeast
    GSTUM_00000447001
Enzymes [BR:tml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     GSTUM_00000447001
Protein kinases [BR:tml01001]
 Serine/threonine kinases: AGC group
  PKA family
   GSTUM_00000447001
Messenger RNA biogenesis [BR:tml03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     GSTUM_00000447001
Chromosome and associated proteins [BR:tml03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    GSTUM_00000447001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 9184421
NCBI-ProteinID: XP_002837656
INRA: GSTUM_00000447001
UniProt: D5GBF4
AA seq 356 aa AA seqDB search
MAQSQETGNNSTGNSSQEKPSEEQQRQQQAAVRTTKGKYSLSDFTISRTLGTGSFGRVHL
VQSRHNLRFYAVKVLKKAQVVKMKQVEHTNDERRMLQKVKHPFLITLWGTFQDGKNLYMV
MDFIEGGELFSLLRKSQRFPNPVAKFYAAEVALALDYLHSHHIIYRDLKPENLLLDRHGH
LKITDFGFAKEVPDITWTLCGTPDYLAPEVVASKGYNKSVDWWSLGILIFEMLCGYTPFW
DGGSPMKIYENILKGRVKYPAYIHPDAQDLLQQLITPDLTKRLGNLLHGSSDIKQHQWFA
EVNWDRLAKRDIEAPYVPPVRGGVGDSSQFDRYPEEQDEYGVDDGFDQHGHLFEEF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaatcacaagagacgggaaataattccactggaaattcttcgcaagagaagccg
tctgaagagcagcagcggcagcaacaagctgctgttaggacgactaaaggaaagtattcc
ttgagcgatttcactatttcgcggaccctaggtactgggagttttggtcgtgtacacctt
gtccagtcacggcacaacctccgcttttatgctgtcaaggtcctcaaaaaggcacaggtt
gtaaagatgaaacaggtagagcataccaacgacgagcggcgcatgttacagaaagttaag
caccccttcttgataacgttgtggggaactttccaggatggcaagaatctttatatggtg
atggatttcatcgaaggaggggaactctttagtctgctacggaagtcgcagcgatttccg
aaccccgttgctaaattctatgctgcggaggttgctcttgccctcgattacctgcactct
caccacataatctaccgagatctcaaaccggaaaatctgctcctagaccggcacggccat
ctgaagattacggatttcggttttgccaaggaggttccagacataacctggacgctctgc
ggcactccggattatctagcgccggaggtagttgcttcgaaaggatacaataaatctgtg
gactggtggtccctcggtatccttatcttcgaaatgctctgcggttataccccattctgg
gacggaggcagccctatgaagatctacgaaaacatcctcaaaggccgagtcaaataccct
gcatatatccatcccgacgctcaagacctcctccaacaattgatcacccctgatctaaca
aaacgcctggggaatttattgcacgggagtagtgatatcaagcaacaccaatggttcgca
gaagtcaactgggatcgcttagcaaagagagacattgaagccccatacgtaccgccagtg
cgtggaggagtaggcgattcgagtcagttcgaccggtacccggaagagcaagatgagtat
ggggtagacgatggattcgatcaacacgggcatctttttgaggagttttga

DBGET integrated database retrieval system