KEGG   Tuber melanosporum: GSTUM_00001086001Help
Entry
GSTUM_00001086001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
tml  Tuber melanosporum
Pathway
tml00790  Folate biosynthesis
tml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GSTUM_00001086001
Enzymes [BR:tml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     GSTUM_00001086001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-GeneID: 9181616
NCBI-ProteinID: XP_002838421
INRA: GSTUM_00001086001
UniProt: D5GDL9
AA seq 279 aa AA seqDB search
MPPPINTDQLTNQIDHRVFRIRENGGPANDIVPTESTTNQRRRTSIALALGDAHPRAELE
ASRRQFVDYDGLSWPSSGTRERLEATPAEAEARLEKLSGAIRTILECIGEDPDREGLLET
PSRYAKAMLYFTKGYEENLKLIINNAVFREDHDEMVIVKDIEIYSMCEHHLVPFTGKMHI
GYIPRGKVLGLSKFARIAEMFARRLQLQERLTKQVAVAIEEILEPLGVAVVMESAHLCMV
MRGIEKTTATTTTSSMLGCFRKRTRTREEFLRLALNSTR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcccccaccaataaacacggaccagctaaccaaccaaatcgatcaccgtgtgttccgg
atccgtgagaatggaggccccgcaaacgatatcgtgccgaccgaatctaccactaatcag
cgaaggcggacgtccattgctttggctcttggcgatgcgcacccccgcgcagaactggag
gcttcgagacggcagttcgttgattatgacggattgtcgtggccgagttcgggcacgagg
gaaaggttagaagctacgccagccgaggcggaagctaggcttgagaagttgtctggggca
attaggacgatactagaatgtattggcgaagaccccgaccgcgagggtctcctagagaca
ccctcccgatacgcaaaagcgatgctatacttcacgaaaggttacgaggagaacctcaag
ctaatcatcaataacgccgttttccgggaagaccacgacgaaatggtaatagtcaaagac
attgaaatctactccatgtgcgaacaccacctggtccctttcaccgggaagatgcacatc
ggctacattccacggggcaaagttctaggcctctccaagttcgctcgtatagcggagatg
tttgcccgacgcttgcagctacaagagcgcctaacgaagcaggttgctgtggcgatcgag
gagattttggaacccctgggagtcgcggtggtcatggagagtgcacacttgtgcatggtc
atgaggggcatagagaagacgacggctactacaaccactagttctatgcttgggtgcttt
aggaagaggactaggaccagggaggaatttctgagactggcgttgaatagtacgagatag

DBGET integrated database retrieval system