KEGG   Tuber melanosporum: GSTUM_00004475001Help
Entry
GSTUM_00004475001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tml  Tuber melanosporum
Pathway
tml00062  Fatty acid elongation
tml00071  Fatty acid degradation
tml00280  Valine, leucine and isoleucine degradation
tml00310  Lysine degradation
tml00380  Tryptophan metabolism
tml00410  beta-Alanine metabolism
tml00640  Propanoate metabolism
tml00650  Butanoate metabolism
tml01100  Metabolic pathways
tml01110  Biosynthesis of secondary metabolites
tml01130  Biosynthesis of antibiotics
tml01200  Carbon metabolism
tml01212  Fatty acid metabolism
Module
tml_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    GSTUM_00004475001
   00650 Butanoate metabolism
    GSTUM_00004475001
  Lipid metabolism
   00062 Fatty acid elongation
    GSTUM_00004475001
   00071 Fatty acid degradation
    GSTUM_00004475001
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GSTUM_00004475001
   00310 Lysine degradation
    GSTUM_00004475001
   00380 Tryptophan metabolism
    GSTUM_00004475001
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GSTUM_00004475001
Enzymes [BR:tml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GSTUM_00004475001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 PrpR_N
Motif
Other DBs
NCBI-GeneID: 9181196
NCBI-ProteinID: XP_002835954
INRA: GSTUM_00004475001
UniProt: D5G6G8
AA seq 288 aa AA seqDB search
MFARFIRPTPARLISPIVPRLVHPMSSLSSKSYEHILVSSPRPGVGQVTLNRPKVNALNT
PLMSELNDALRAFDDSKAIGAIIITGSERAFAAGADIKEMQNLTFSEAYSKDFIRLWSDV
TQISKPVIAAVNGHALGGGCELAMMADIIYCGPTATFGQPEITLGVIPGAGGSQRLVRAI
GKARAMELILTGKTFSAEEAERWGLVARVFETPEKCVEGALETAETIAGYGALAVKAAKE
VVNQSFEVGLSEGVKYERRVFHALFSTKDQKTGMTAFVNRTKPEWAGE
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctcgtttcattcgacctacccccgcccgccttatttctcctatagtccctcgt
cttgtccatccaatgtcttccctaagctctaaatcttacgaacacattctggtttcttcc
cccaggccgggtgtagggcaggttactctcaaccgcccaaaagtcaatgccttgaacact
cctcttatgtccgagcttaacgatgctcttcgcgcattcgatgactcaaaggcaatcggt
gcaattatcattaccggcagcgaaagggctttcgctgcgggcgccgatatcaaggaaatg
cagaacttgacattctcggaagcgtacagtaaagactttatcaggctgtggtcggacgtc
acgcaaatatcgaaacccgtcatcgctgctgtcaatgggcacgctcttggaggcggttgc
gaactcgccatgatggccgacatcatctattgtggaccaacggctacattcggccaaccg
gaaatcacattgggagttatcccgggcgcaggaggatcccagcggctagttagagctatc
gggaaagcgagggctatggaattaattctcactggaaagacgttctctgctgaggaagcg
gagagatggggccttgtggcgagggtgtttgagactcctgagaaatgtgttgagggagca
ttggaaaccgcagagacgattgcgggatacggagcgctggcggtaaaagcggccaaggag
gttgtcaatcagagtttcgaggttgggttgagtgagggtgtgaagtacgagaggagggta
ttccatgcattgttctctactaaggatcaaaagaccggaatgactgcgtttgtcaatagg
acaaagcctgaatgggccggagaatag

DBGET integrated database retrieval system