KEGG   Tuber melanosporum: GSTUM_00005658001
Entry
GSTUM_00005658001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
tml  Tuber melanosporum
Pathway
tml00100  Steroid biosynthesis
tml01100  Metabolic pathways
tml01110  Biosynthesis of secondary metabolites
Module
tml_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:tml00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    GSTUM_00005658001
Enzymes [BR:tml01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     GSTUM_00005658001
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 9185433
NCBI-ProteinID: XP_002837807
INRA: GSTUM_00005658001
UniProt: D5GBJ2
AA seq 424 aa
MPPPAHGYEFGGPLGAFAISLAAPAATYALYFVCNEDGCPSSSFLRDPVGNIASKWPGLS
GAFDWGVTKHYFLWYFALAIMYFVLPGKIGDGVVLSNGRRLKYKFSGSASLLTVFAYCGF
MTYKEGFQWPFWAYIWDNQLQLMTAALISSIILAFYCYISSFFTGELLANDTGNFIYDWF
LGRPLNPRIGSFDIKVFSELRPGMILWPILNFAFMAHQYNTHGKITDSMILVNAFHLWYV
CDALHNEPAVLTTMDVTTDGFGFMLSFGDLMWLPFNYSLQSRYLAMHPFELGLLGVVGVL
AVQGLGYWIFRRANREKHDFRTDPNDPKLAHIKYIETKSGSRLMITGWWGIARHINYLGD
WIMAWAWCLPTGYRGPLSYFYVVYFAILLLHRDRRDEAKCKLKYGADWKRYTDLVPSRIV
PGIY
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgcctcctccagctcacggatatgaatttggcgggcctttgggggcctttgctatttca
cttgctgcaccagcagccacatatgctctttactttgtctgcaatgaagatgggtgcccg
agtagttcattcttacgagatccggttgggaatattgcttcgaaatggccgggactgtcg
ggagcattcgactggggcgttacgaagcactactttctctggtatttcgccttggcaatt
atgtactttgtccttccggggaagataggggatggtgttgtgttgagcaatgggaggagg
ttgaagtacaagtttagcggctctgcttctctcttgactgtttttgcgtactgtggattc
atgacctacaaggagggattccagtggccattctgggcatacatttgggataaccagctc
cagctcatgactgctgccttgatatcctctattattcttgcattctactgctacatctct
tctttctttaccggggagcttttggcgaacgacactggaaattttatttacgattggttc
ctcggccgccctctcaacccgcgtatcggcagttttgacatcaaagttttcagcgaactc
cgacccggcatgatcctctggccaatcctaaactttgccttcatggcccaccaatacaac
actcatggcaaaatcaccgatagcatgatcctcgtcaatgctttccacttatggtacgtc
tgtgacgcactccacaatgagccagcggtcctcacgacaatggacgtgaccaccgatggt
ttcggattcatgctttcattcggagacttgatgtggctgccattcaactactctcttcaa
tcccgatacctcgccatgcaccctttcgaactcggccttctaggtgtcgtcggggttctg
gctgttcagggattgggctactggatcttcaggagagctaatcgtgaaaagcacgacttt
aggactgatcctaacgatcccaagctggctcatatcaagtacatcgagaccaagagtgga
tcaaggttgatgatcactggctggtggggtatcgctagacatatcaactacttgggggac
tggatcatggcttgggcgtggtgtctgccgacaggatatagaggccctctcagctacttc
tacgtcgtctactttgccattctgctccttcatcgggaccgcagggacgaggctaagtgc
aagctcaagtacggagcggactggaagaggtatacggaccttgtcccatcaaggattgtc
ccggggatctattga

DBGET integrated database retrieval system