KEGG   Tuber melanosporum: GSTUM_00005876001Help
Entry
GSTUM_00005876001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
tml  Tuber melanosporum
Pathway
tml00564  Glycerophospholipid metabolism
tml00565  Ether lipid metabolism
tml00590  Arachidonic acid metabolism
tml00592  alpha-Linolenic acid metabolism
tml01100  Metabolic pathways
tml01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tml00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    GSTUM_00005876001
   00565 Ether lipid metabolism
    GSTUM_00005876001
   00590 Arachidonic acid metabolism
    GSTUM_00005876001
   00591 Linoleic acid metabolism
    GSTUM_00005876001
   00592 alpha-Linolenic acid metabolism
    GSTUM_00005876001
Enzymes [BR:tml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     GSTUM_00005876001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 9186386
NCBI-ProteinID: XP_002838013
INRA: GSTUM_00005876001
UniProt: D5GCG1
AA seq 822 aa AA seqDB search
MYNTARVGLGALVTTGAVVMFYRTQIHRRILPVNERVTPGNAAVGSNGKQKGDNDETENE
KAEPDESDGKAKKGILSAIKGTFGQLVVQQTPKKNPEPTPDDDLQKKSIGVVQAREEGQL
NQRDALTDTQWLTFSNKLLVAKESILSIDWPKLNNLTNVFPDWATGLPEWVTKLQRELNM
EPGSLADEIWSEAQDPKVNPEVEKDAHVRLGKDLCEEEQRYLASRKGFTKQGLAQYLNIP
ESDIHDDDVPIIATTGSGGGLRAMVAGAGYYQALTEAGLYDCTTYTAGVSGSCWLQALYL
TSLGKCSFDRVMEHLKARINVHIAYPPKALELVTSAPTNKYLLRGVVERLKTGYSPFTLV
DLYGLLLGARLLVPSNELTLDDTDLKLSAQRRFLENGEQPLPLYTAVRHEIPFIGGENEK
GKPIPEELKEKASKHESWFQWFEATPYEIYCEELEAGIPTWAMGRRFENGVNVSRKVPEM
KLPLLFGIFGSAFCATLSHYYHEIRPFVTSVSLFLSLDKMVLDRNNDLSKVHPIDPCSVP
NFVKGLKESLPSTCPVLVSTQLLTPLKDAGMSNNLACYPLLRPGRNIDILIAFDSSAEIQ
TANWIGYAEGYAKQRKVQGWPVAIGWPKGDNKQRQQELEDAQAHSAKEAQQKLEEAQREA
SEAENDKPLSQRKEEQKKKNALGYCTVWVGSKEERDSGDEPPPSKAVEDDWELMKPNAGI
TVVYFPLIPNEKVPGVDPEISPYLSTWNFEWTPEQIDQTVALAKANFREGAEKLKGTVRA
VYERKKKLRLGMEEKMIEKREKKEEERHEENRRTYGIHDHFS
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacacagcgagagtcgggcttggagcactggtcacaacaggagccgttgttatg
ttttaccggactcagattcaccggaggatactaccggtgaacgagcgggttactccaggg
aatgccgccgttggaagcaacggaaaacagaagggtgataatgatgagacggagaacgag
aaggccgaaccagatgagagtgatggcaaagctaagaagggaatcctctccgcgataaaa
ggaacttttgggcagctcgtcgtgcaacagacaccgaagaaaaacccggaacccacaccg
gatgacgatctgcaaaaaaagagtattggcgtcgtgcaggcccgcgaggaagggcaactt
aatcagagagatgcattaacagatactcagtggctcacattctccaacaaacttctcgtg
gcgaaggaatccatactctccatcgactggccaaagctcaacaaccttacaaatgttttc
cccgattgggctaccggactgccagagtgggtcacaaagcttcagcgagagctaaacatg
gaacccggatcactagcggatgagatttggagcgaagcgcaggaccccaaagtcaatcca
gaggtggaaaaggatgcacacgtgaggttagggaaggatctctgtgaggaagaacaacgc
tacttggccagtcggaagggcttcacaaaacaggggttggcccaatatctcaacattccg
gagtcggatattcacgatgacgatgtgccaattatcgccactacagggtccggcggtggc
ttacgagccatggttgcaggagcaggctattaccaggccctgacggaggccggcttgtat
gattgtacgacatataccgcgggagtttctggtagttgctggttacaggctctttacctt
acttctttggggaaatgctcattcgatcgagtgatggagcatctgaaggcacgcattaat
gtacatatcgcctatccgcctaaagcactcgagctggttacctcggcacctacgaacaag
tacctcctacgcggagtggtggagcgactaaagacaggttactctccattcacccttgtg
gatttgtatggactgttgctgggcgctaggctcctggttccgtcaaatgaactgacgctt
gatgatactgatctgaaattgagtgcccaaaggaggttcttggaaaatggagagcagcct
ttacctctttatacagccgtcaggcacgagattccgttcatcggcggtgagaacgagaag
gggaaaccaattcctgaagagcttaaggagaaggcaagtaaacacgagagttggttccaa
tggttcgaggccactccttacgaaatatattgcgaggaacttgaagctggcatcccaact
tgggcaatgggaaggcgattcgagaatggcgtcaatgtcagccggaaggtgccagaaatg
aaactcccgctactgtttgggatctttggatcggccttctgcgctactttgagccattac
taccacgaaattcgtccatttgtaacatctgtcagtcttttcttatcattggataagatg
gtattggaccgaaacaatgatctctcgaaggttcacccaattgatccttgcagcgttccc
aactttgtaaaaggcttgaaggaatcattgccctctacctgtccggtacttgtttccacc
caattgctaactccactcaaggatgcgggaatgagcaacaaccttgcatgctacccgctc
ctccgtccgggccggaacatcgacatccttattgccttcgattcctcagcagaaatccaa
acagcaaattggataggctacgccgagggttacgccaagcagcggaaggtccagggatgg
cctgtcgcgatcggatggcccaaaggcgacaacaaacaaagacaacaggagcttgaggat
gcccaagcacactcggcaaaagaagcgcaacagaaactggaagaagctcagagagaagct
tccgaagcggagaacgacaaacctcttagtcagagaaaggaggagcagaagaagaaaaat
gcccttggatactgcaccgtctgggttggcagcaaagaggaaagggactccggtgacgaa
ccgcctccaagcaaagctgtggaggacgactgggagttgatgaagccaaatgcagggata
acggttgtctattttccattaattccaaacgagaaggtaccaggtgttgaccctgagata
agcccttacctatccacctggaattttgagtggacaccagaacaaatcgaccaaacagtg
gcgctggccaaagctaattttcgggaaggggctgagaagctgaaggggaccgtcagggcc
gtttatgaacggaagaagaagttgcggttggggatggaggagaaaatgatcgagaagcgt
gagaaaaaggaggaagagaggcatgaagagaatagaaggacatacgggatacatgatcat
ttctcatga

DBGET integrated database retrieval system