KEGG   Tuber melanosporum: GSTUM_00005890001Help
Entry
GSTUM_00005890001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tml  Tuber melanosporum
Pathway
tml00860  Porphyrin and chlorophyll metabolism
tml01100  Metabolic pathways
tml01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GSTUM_00005890001
Enzymes [BR:tml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     GSTUM_00005890001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-GeneID: 9186399
NCBI-ProteinID: XP_002838026
INRA: GSTUM_00005890001
UniProt: D5GCH4
AA seq 292 aa AA seqDB search
METKNVPILFLKARSQPHEQYYEYFTSSPIDGSVFKPVFIPVLKHHHINLDNLKTHLISK
SDPTDPNSYGGLVITSQRTVEALSSIIPALPPTTLQTLFANTKVWVVGPATGSALIGLGF
RASNVLGQDSGNGEALAKLILESYGSRPKPLLFLAGETRRDIIPKTLSTAPGEKNIAVET
LTVYETIVDEEFDAKFEKAIDETGGTTRWIVLFSPAGADIAVGVLTKHLTPLSHGSYLAA
IGPTTEKHLVDKLSWKPDVVAEKPTPQWLWEGIREFMHRDGAKRDDVTVSDD
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggagacgaagaatgtaccaatactattcctcaaggcccgctctcagccgcacgagcaa
tactacgaatacttcacctccagcccaatagacggttccgtcttcaaaccagtctttatt
ccagtcctcaaacatcaccacatcaacctagacaatctgaaaacccacctcataagcaaa
tccgatcccacagatcctaattcatacggaggtctagtaatcacgtcccagcgcaccgtc
gaagccctctccagcataatacccgctctcccaccaacgaccctccaaaccctattcgca
aacacaaaggtatgggttgtcggccccgcaacgggctcagcgctcatcggactaggtttt
agggcgtcaaacgtcctaggccaggactccggcaatggggaagctctagcaaagttgatc
ctagaatcctacggatctcggccaaaaccgcttctgtttctcgcaggagagaccagaaga
gacataattcccaagacactttctacagctcccggggagaagaatatcgcggtggagacg
ttgacggtatacgagactattgtggacgaggagttcgatgccaaatttgagaaggcgatc
gatgagacgggaggtacgaccaggtggatagttctgttctcccctgcgggggcggacata
gcggttggtgtattgacgaagcatctcactcctctctcccatgggtcatatctggcggct
attggccccacaacagagaagcaccttgtcgacaagttgtcttggaaaccagatgttgtt
gctgaaaagccgacccctcaatggttgtgggagggtatccgagaatttatgcaccgagat
ggggctaagagggacgatgtaacggttagtgatgattag

DBGET integrated database retrieval system