KEGG   Tuber melanosporum: GSTUM_00007119001Help
Entry
GSTUM_00007119001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
tml  Tuber melanosporum
Pathway
tml00052  Galactose metabolism
tml00500  Starch and sucrose metabolism
tml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    GSTUM_00007119001
   00500 Starch and sucrose metabolism
    GSTUM_00007119001
Enzymes [BR:tml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     GSTUM_00007119001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 9181755
NCBI-ProteinID: XP_002839219
INRA: GSTUM_00007119001
UniProt: D5GFW7
AA seq 607 aa AA seqDB search
MLRSTVLLALLAGSLAVGLDINANTNLTELPMNSLFTKWRPTYHFTAPRGWLNWNPNGVQ
WGNISWGHAVSRDMVDWVDVGGWKGDAAAALVTGPGTYDSKGVFSGTGHAVNLQGEVNGT
LALFYTSVSALPTAWNIPYIPNTESQSFALSHNGGETWGKYPGNPIMIDPPSGWNITGWR
DPFYLPWPEMDALLNKTEPHWYMVMGSGIRGVGPRIPFYSAPARNLTQWTFLGALWEPKN
NETFGDVLETGSYGFNFEVSGFFSLKDKQGNDHFFATMGAEGGGVPGHGRWSLWAEGEMS
RRANGSAQFDPVAVGAADWGNLYAITSFNDTKGCRRVTWGWSQEDMNDYGVNAQGFQGAM
GLPRELFVHKTYKVVADNKTASTPTNARYSKPGPDGTFTLTSLGIKPLPGVVERLRRRAQ
QHQIKDRRYTCPEKLDGISSDHFELSATIRGGADGPVGFTVRASPGGEEVTTITFDPANN
LVAVDRSKSSLIKQFSNLTASGDYKPYTISHRRDIGHGGEDYGVGEAAVVEDIEMNIFVD
GSLVEVFVGGRFALTTRVYPARDDALGVGVYVGEGVEAEIVDLKVWSGTGSVWPERPVDT
SNTTSAA
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgctccgctctaccgttctcctcgctttgctggccggaagcctcgcggtgggccttgat
atcaatgccaacactaacctgaccgaattgccgatgaatagcttgtttacgaagtggcgt
ccgacatatcattttactgctcctcgggggtggctgaactggaaccccaacggtgtccag
tggggcaacatctcctggggccatgctgtctcccgcgacatggtagactgggtcgacgtg
ggcgggtggaaaggcgacgccgccgcagccctagtgactgggccgggcacctatgattcc
aaaggagtattctccggcaccgggcacgctgtcaatctccaaggcgaggtcaatggcact
ctcgcgctcttctacaccagtgtgagcgctctaccaacggcctggaacatcccgtacatc
ccgaataccgaatcgcagtcattcgctctctcccacaacggcggggagacgtgggggaag
tatcctggtaacccgattatgatcgatcccccgagtgggtggaacatcaccggctggcgt
gatcctttctaccttccctggccggaaatggatgctcttttgaacaagaccgaaccacat
tggtatatggttatgggaagtggaatccgtggtgttgggccgaggattccgttctattct
gcgcccgctaggaaccttactcagtggactttcttgggcgcgctttgggagccgaagaat
aacgagacatttggggatgtgctggagacggggtcttatgggtttaactttgaggtttcc
ggatttttctcattgaaagataagcagggaaatgatcacttttttgctactatgggagct
gagggaggtggcgtccccggacacgggcgttggtcgttgtgggccgagggagagatgagt
cgtcgcgctaatggctccgctcaattcgaccctgtcgccgttggagctgcagattggggt
aatctctacgctatcaccagcttcaacgacaccaaagggtgtcgccgcgtgacctggggt
tggagtcaggaggacatgaacgactacggcgtgaacgcccaaggctttcaaggcgccatg
ggcctgccccgggaactcttcgtccacaagacctacaaggtggtagcagacaacaaaacc
gccagcactccaacaaacgcaaggtactccaagcccggtccagacggaaccttcaccctg
acgagcctgggcataaagcctctcccaggcgtggtcgagcgcctgcgccgaagagcacag
cagcaccagatcaaggacaggaggtacacatgcccggagaaactggatggcatttcctcc
gaccatttcgaattatcggccaccattcgcgggggggcggacggcccggtcgggttcacg
gttcgcgcctcgccggggggtgaggaggtcaccaccatcacgttcgatccagcaaacaac
ctcgtcgccgtcgataggtcaaagtcctcgctcatcaaacagttcagcaatctcaccgcg
agcggggactacaaaccttacacaatctcccaccgccgtgatatcggccacggcggtgaa
gactatggcgtgggagaagcagcagtagtcgaggacatagaaatgaacatcttcgtcgat
ggaagcctcgtggaggtattcgtcggcggcaggttcgcgctcacaaccagggtttatccg
gcccgtgatgatgcgctcggtgtcggggtttatgtcggcgagggggttgaagccgagatc
gtggatctgaaggtctggagcgggaccgggagtgtctggcccgagaggccggtggacact
tcgaacaccacatctgctgcttga

DBGET integrated database retrieval system