KEGG   Tuber melanosporum: GSTUM_00008015001Help
Entry
GSTUM_00008015001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
tml  Tuber melanosporum
Pathway
tml00020  Citrate cycle (TCA cycle)
tml00640  Propanoate metabolism
tml01100  Metabolic pathways
tml01110  Biosynthesis of secondary metabolites
tml01130  Biosynthesis of antibiotics
tml01200  Carbon metabolism
Module
tml_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tml_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GSTUM_00008015001
   00640 Propanoate metabolism
    GSTUM_00008015001
Enzymes [BR:tml01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     GSTUM_00008015001
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GSTUM_00008015001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 IlvN
Motif
Other DBs
NCBI-GeneID: 9183689
NCBI-ProteinID: XP_002839844
INRA: GSTUM_00008015001
UniProt: D5GHS4
AA seq 326 aa AA seqDB search
MLALKRLSTFRVASVTRGYSTSSGYASTAKNLLINADTKVIFQGFTGKQGTFHAQQAIEY
GTNVVGGISPRKAGSQHLDRPVFGTVKDAISKVGADASAIFVPPPVAAKSIEEAIEAEIK
LVVCITEGIPQNDMVRVVDMLKTQNKTRLVGPNCPGIISPGQCKIGIMPGFIHKRGRIGV
VSRSGTLTYEAVNQTTQVGLGQSLVIGIGGDPFSGTSFTDALSVFLGDDETDGIIMIGEI
GGSAEEDAADYLKANNPKNKPIVSFIAGISAPPGRRMGHAGAIVSGGKGGAESKISALED
AGAIVERSPASLGKSLYEQFVKRDLL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctctgaagcgtctatcaaccttccgtgtagcctccgtgactcgcgggtattcg
acctcctccggctacgcttctactgcgaagaatttgctcattaacgctgatactaaggtt
atctttcaaggatttaccggaaaacagggaacgttccatgcgcaacaggcgattgagtat
ggtacgaatgttgttggcgggattagtccgaggaaggccggaagccagcatttggatcgt
ccggtttttggtactgtgaaggatgctatcagcaaggtcggagccgatgctagcgctata
ttcgttccacctccggtcgcggcaaagtctatcgaggaggccatcgaggcggagatcaag
cttgttgtttgtatcactgaggggattcctcagaatgacatggtccgggttgtggatatg
ttgaagacgcagaacaagaccagattagtgggaccgaactgccccggaatcatttcccca
ggccagtgcaagattggtattatgccgggtttcatccacaagagaggcaggatcggtgtt
gtctctagatctggaactctaacctacgaggctgtaaaccaaactactcaggttggactt
ggccaaagcttggttattggtatcggaggtgatccattctccggaacctctttcactgat
gccttgagtgttttcttgggagatgatgaaaccgatggaatcatcatgatcggtgaaatc
ggaggttccgcagaagaagatgctgcggattacctgaaagccaacaaccccaaaaacaag
cccatcgtatcattcatcgccggcatctccgcgccaccagggaggcggatggggcacgcc
ggtgccatcgtcagcggcggcaagggaggggccgagtctaagatctcggcactcgaggat
gctggcgccattgtcgagcgtagccccgcctccctcggaaagagtctttacgaacaattt
gtaaagcgtgacttgttgtga

DBGET integrated database retrieval system