KEGG   Tuber melanosporum: GSTUM_00010169001Help
Entry
GSTUM_00010169001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K04709  Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
tml  Tuber melanosporum
Pathway
tml00600  Sphingolipid metabolism
tml01100  Metabolic pathways
Module
tml_M00094  Ceramide biosynthesis
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    GSTUM_00010169001
Enzymes [BR:tml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     GSTUM_00010169001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1
Motif
Other DBs
NCBI-GeneID: 9186089
NCBI-ProteinID: XP_002841154
INRA: GSTUM_00010169001
UniProt: D5GLF2
AA seq 419 aa AA seqDB search
MGRPRRTSSLGEDIRGDTSAPGISTMSTSHAQRAASRSRRRALSKPRPPSKSRAQSFFTW
YREISYRRTWINPLVAMALVMGAYGLNPTPENPLHACIFLSYPEPPDPTSHAPTETQYGK
GMNDFLFVLFYTFFFSFTREFLMQQVLRPLAIWCGIAKKSKVSRFMEQTYTAIYFSIFGP
FGLYVMSRTPIWYFNTTAFYERYPHYTHTADFKTYYLLQAAYWSQQAIVLMLQLEKPRKD
FKELVLHHIVTLSLIGLSYRFHFTWIGVAVFVTHDISDFFLATSKTLNYLDHPFTGPYFA
FFILVWIYMRHYINLKVIWSILTEYETVGVWELDWVTQVYKCRIAQVITGGLLGSLQAVN
LFWLWLILKIAWRYAVSNIAQDERSDDEDEEEESSESVEADSPKPHITCEDEQEIKKKM
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgggtagaccgagacgaacatcctccctgggcgaggacatccggggtgatacttcagct
cctggaatatcaaccatgagcacatcccacgcacagagagctgcttcacgaagtcgacga
agggctttatccaaacctcggccaccatcgaaatcccgagctcagagctttttcacctgg
taccgcgagatctcttaccgcaggacatggataaaccccctggtggctatggccctggta
atgggagcttatggcttgaaccccactcccgagaatccattacatgcttgtattttctta
tcctatcccgaacctccggatccgacctcacatgcgcctacagagacgcagtatggtaaa
ggaatgaacgactttctctttgttctattttacaccttcttcttctctttcactcgtgag
ttcctcatgcagcaggtcttgcggccgctagcgatctggtgtggtatcgccaagaagtcc
aaagtttcccgcttcatggagcagacttacaccgcaatctatttctctatcttcggccca
ttcgggttatacgtaatgtctagaacaccaatctggtactttaatactacagcattctac
gaaagatacccgcactatacccacacagccgatttcaaaacctactacctcctccaagct
gcatactggtcgcaacaagcgatagtcctaatgctccaacttgagaagccgcgcaaggac
ttcaaagagttggtattgcaccacatcgtgaccctctcactcataggcctctcctaccgt
ttccacttcacttggatcggggttgccgttttcgtcacccacgacatttcggacttcttc
ctcgcaacttccaagacgctaaattacctcgaccacccattcacaggtccatactttgcc
ttcttcattctcgtttggatctacatgcgtcactacatcaacttgaaggtcatctggtcc
attctcacggaatacgagaccgtcggagtctgggaactcgactgggtcacccaagtgtac
aaatgtcgcatcgcacaggtcatcacaggcggtcttttgggtagtctgcaagcagtgaat
ctcttctggctatggctaatcttgaagattgcgtggagatatgccgttagcaacattgcc
caggacgagcgcagcgatgatgaagatgaagaggaggagagcagtgagagtgttgaggct
gactccccaaagccgcatatcacctgtgaagacgaacaagagattaagaaaaagatgtaa

DBGET integrated database retrieval system