KEGG   Tuber melanosporum: GSTUM_00010229001
Entry
GSTUM_00010229001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
tml  Tuber melanosporum
Pathway
tml00910  Nitrogen metabolism
tml01100  Metabolic pathways
Module
tml_M00531  Assimilatory nitrate reduction, nitrate => ammonia
tml_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:tml00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    GSTUM_00010229001
Enzymes [BR:tml01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     GSTUM_00010229001
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Fer2_BFD Pyr_redox Rieske Rieske_2 NIR_SIR_ferr Pyr_redox_3 Rubredoxin_C FAD_binding_2 AlaDh_PNT_C
Other DBs
NCBI-GeneID: 9186127
NCBI-ProteinID: XP_002841192
INRA: GSTUM_00010229001
UniProt: D5GLJ0
AA seq 1110 aa
MDSKPSIANEDGPTETNGANGMTNDMSGGENGTAPPSPQRKRIVIVGLGMVAIAFIEKIL
KLDAESKQYEIVVIGEESHVAYNRVGLTSFFEHRKVEDLYLNPKEWYESKPGVLNHKINT
KVTAIDPISKSITTSAGYDVTYDILVLATGSDAVVPSNTPGHDSEGVFVYRNIEDLEKLI
SFSATVNESTGCVVGGGLLGLEAAKAMMDLERFKYVKLIDKNPWVLSRQLDQDAGRLVLE
KVTELGLDVLSCRKIKTINSDENNQTKSVTFEDGETMETTCICFAIGIKPRDELADSAGI
KTASRGGFIINKDVETTVPGIYAIGECASWENQTFGLIAPGVEMADVLAFNLCKSTSHGH
SEAPKAFRRPDLSTKLKLLGVNVASFGDFFADRDGPKELPGRSPSQERRGREVKALSYRD
PFQAVYKKYIFTSDGKYLLGGMIIGDTMDYIKLVGMVKSKKALEVPPSQLILGAKTEGEE
NPDDLDDDTQICSCHNVTKGDISKAVKDGSCKSLGDVKSCTKAGTGCAGCIPLVQTIFNA
EMKAMGAEVSNHLCPHFAYSRADLFNIIRVKEIKTFPEVMRECGKDPESLGCEVCKPTMG
SIFSSLFNQHVMDKPLHMLQETNDKFLANIQRNGTFSVVPRVPGGEITPDKLIAIGTVAK
KYSLYCKITGGQRIDMFGARKQDLVAIWSELVEAGMESGHAYAKSLRTIKSCVGTTWCRF
GVGDSVGMAIRLEERYKSIRAPHKIKSGVSGCIRECAEAQNKDFGLIATETGYNIFVAGN
GGSKPRHSELLIKDCPVERVIPILDRYLMFYIRTADRLQRTARWIENLPGGIKYLKEVIL
DDKLGICDQLEKEMQDLVKTYFCEWTEVVKDSERRKQFQQFANTSDASETVEIINERSQS
RPTYWPKGSVKYDFKNHRWSNLAWQPIIEASYFSSANLSTPVTAAVKRGDTQLAIFKVRG
KYYATQQMCPHKRAFVLSDGLIGEDPDDGTEECKEKRKMWVSCPYHKRNFTLDGKTPGGC
ANDEEVSIATFDVEERSDGWVYLKLPSVAELDALLGTERWKVKKEESEDPFKDMDKKINS
SNKGRKAVKPTEAAGGNGSPTEKKINGLEW
NT seq 3333 nt   +upstreamnt  +downstreamnt
atggacagcaaaccttcaattgccaatgaggatggcccgactgaaacgaatggagccaac
ggaatgacgaatgatatgtcaggtggtgaaaatggcacagccccaccatcgccccaaaga
aaacgaatagtaattgttggcctggggatggtagcaattgcattcattgaaaagatccta
aagcttgatgccgaaagcaaacagtacgagatcgtggttatcggggaggagtctcatgtg
gcatacaaccgtgtgggattgacttcatttttcgaacaccgaaaggtcgaggacctctac
ttgaatccaaaagaatggtatgaatcaaaaccgggtgtcctaaaccacaaaatcaacacc
aaagtcacagccatcgatcctatatcaaaatcaataacaacatccgccggctacgatgta
acctacgatattctagtgttagcaactggctccgacgctgttgtcccatcaaatacgccc
ggacatgacagcgagggagtatttgtttaccggaatatcgaggatttggagaagttgata
tcattctctgccacagtaaatgaatcaaccggttgtgtagtgggtggtggattacttggt
cttgaagccgcgaaagcgatgatggacctcgagcggtttaaatatgtcaagctaattgat
aaaaacccttgggttttgtcaagacagctagatcaagatgccgggagattggtgcttgag
aaggttacagagctgggacttgacgtattaagttgcagaaagattaagacgatcaattcc
gacgagaataatcaaaccaagagtgtcacgtttgaggatggagagaccatggaaactaca
tgtatttgctttgcaattggtatcaaacctagagatgagctcgctgatagtgccggaatc
aagactgccagtcgcgggggttttattattaacaaagacgtcgaaacaacagtccctggg
atttatgcgatcggggaatgtgcttcatgggaaaaccaaactttcggtctgattgctccc
ggagtcgagatggccgacgtccttgcattcaatctctgcaaatcgacttcgcatggccat
tctgaggcaccaaaagctttcagacgccctgatctctcaaccaaactgaagttgcttggt
gtcaatgtcgcttcctttggtgactttttcgcggaccgggatggacctaaagagttgcct
ggtcgctctccaagccaggagaggagaggaagggaagtcaaggcacttagttacagagat
cccttccaggctgtttacaaaaagtacatttttacgtcagatggaaaatatctacttggt
ggcatgattattggggacacaatggactatattaaactcgtaggaatggtcaagtccaag
aaagcgttggaagtcccgccttcgcaattaatattaggcgcaaaaaccgagggagaggag
aacccagacgacttggacgacgacacccaaatttgctcatgccacaacgtaacgaaagga
gatattagcaaagcggtgaaagacggcagctgcaagagcttgggagatgtcaagtcttgc
acaaaagccggcaccggatgtgctggctgcataccactcgttcagacaatcttcaatgca
gagatgaaggccatgggagccgaagtttcaaatcatctttgcccacacttcgcctactcc
cgtgctgaccttttcaatattattagagtgaaggaaataaaaaccttccctgaagtaatg
cgcgagtgcggtaaagatcccgaatcgcttggctgtgaggtatgcaagccgactatgggg
tctatattttcttctctcttcaaccagcatgtaatggataaacctttgcacatgcttcaa
gagacgaacgataagttccttgcaaacattcagcgaaacgggaccttctcggttgttcct
cgggtgcccggcggggaaatcacgcccgataaactcatcgctattggtacagtagcgaag
aaatatagtttgtattgcaagatcactggtgggcagaggattgatatgttcggtgcgcga
aaacaagacttggtggccatctggtcagagcttgtagaggcggggatggagagtgggcat
gcttacgctaagagtttgagaacaatcaagagctgtgtagggactacatggtgccgcttc
ggtgtcggcgacagtgttggcatggcaatcaggctggaagagcggtacaaaagtattcgt
gcgccacataaaattaaatctggtgtttcgggatgtattcgggaatgtgcagaagcccag
aacaaagacttcggccttattgccaccgagacagggtacaacatctttgttgctggaaac
gggggctccaagcctcgccactccgaactcttaatcaaggattgtcccgtagaaagggtt
atcccgatcctggaccgctacctaatgttctacatccgtaccgcagacaggctccagaga
acagcccgctggattgaaaatctcccgggaggaatcaaatacctaaaggaagtaatcctg
gacgacaagctcgggatttgcgaccagctcgaaaaggaaatgcaagacttggtgaagacc
tacttctgcgaatggacggaagttgtgaaagactcagagcgacgaaaacaattccagcaa
tttgccaacacctccgacgccagcgagaccgtagaaattatcaacgagcgctcccaatcc
aggccaacatactggcccaaaggaagtgtaaaatacgacttcaaaaaccaccgctggtca
aatctagcctggcaacccatcatcgaagcctcatacttctctagcgcgaatctctcaaca
cccgtaactgctgcggtcaagcggggtgatacccagctcgccatcttcaaagtgagaggc
aaatactacgccacccagcagatgtgtcctcacaagcgggccttcgtcctctcggacggc
ctgataggcgaagacccggacgacggcacggaagagtgcaaggagaagaggaaaatgtgg
gtcagttgcccgtatcacaagaggaacttcacacttgacggcaagactcccggcggatgt
gcgaacgacgaagaggtcagtattgcgacgtttgatgtggaagagagaagtgacgggtgg
gtttacttgaagttgccgagtgtggcggagttggacgccttgctagggaccgagaggtgg
aaggtcaagaaggaggagtcggaagatccgtttaaggacatggacaaaaagattaatagt
agtaacaagggacggaaggctgttaagcccaccgaggccgcgggtgggaatggaagtccg
acggagaagaagatcaatgggctagagtggtag

DBGET integrated database retrieval system