KEGG   Thermotoga maritima MSB8: Tmari_0556Help
Entry
Tmari_0556        CDS       T02663                                 

Definition
(GenBank) putative metal-dependent phosphoesterases (PHP family)
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
tmm  Thermotoga maritima MSB8
Brite
KEGG Orthology (KO) [BR:tmm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Tmari_0556
Enzymes [BR:tmm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     Tmari_0556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP PHP_C pPIWI_RE_REase Radical_SAM Citrate_bind
Motif
Other DBs
NCBI-ProteinID: AGL49481
UniProt: R4NQI3
Structure
PDB: 

Position
590223..590954
Genome map
AA seq 243 aa AA seqDB search
MKTDTEWLLCDFHVHTNMSDGHLPLGEVVDLFGKHGVDVVSITDHIVDRRTLEQRKRNGE
PLGAITEDKFQDYLKRLWREQKRAWEEYGMILIPGVEITNNTDLYHIVAVDVKEYVDPSL
PVEEIVEKLKEQNALVIAAHPDRKKQDEEHLSWYLWANMERFKDTFDAWEIANRDDLFNS
VGVKKYRYVANSDFHELWHVYSWKTLVKSEKNIEAIKEAIRKNTDVAIYLMRKNRLSSLS
DVI
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgatacggaatggcttctttgtgatttccatgtacacacgaacatgagtgac
gggcatcttcctctgggagaagtggtggatctgtttggaaaacatggagtggacgtggtt
tccataacagatcatatagtcgaccgaagaactctcgagcagagaaagaggaacggagaa
ccgctcggagcgatcacagaagataagtttcaggattatttgaaacgtctctggagagaa
cagaaaagggcctgggaagaatatggaatgatcctcataccgggtgttgagatcacgaac
aacacggatctgtaccacatagtcgccgtggatgtgaaggagtacgtagatccttcactg
cctgtagaagaaattgtggagaagttgaaggagcaaaacgctcttgttatagccgcgcat
ccggatagaaaaaagcaagatgaagaacatctttcgtggtatctctgggcgaacatggag
cgtttcaaggacacgttcgacgcgtgggaaatcgcgaatcgtgatgacctgttcaactct
gttggtgtgaaaaagtatcgatacgtggcgaactccgattttcacgaactttggcacgtt
tactcctggaaaacccttgtgaagtcggagaaaaacatcgaggcgataaaggaagcaatc
agaaagaacacggatgtggcgatctatttgatgagaaaaaacaggttgagttctctgtca
gatgtgatataa

DBGET integrated database retrieval system