KEGG   Thermotoga maritima MSB8: Tmari_1775Help
Entry
Tmari_1775        CDS       T02663                                 

Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
tmm  Thermotoga maritima MSB8
Pathway
tmm00670  One carbon pool by folate
tmm01100  Metabolic pathways
tmm01120  Microbial metabolism in diverse environments
tmm01200  Carbon metabolism
Module
tmm_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:tmm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Tmari_1775
Enzymes [BR:tmm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     Tmari_1775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA AAA_31
Motif
Other DBs
NCBI-ProteinID: AGL50699
UniProt: R4P1X2
Structure
PDB: 

Position
1742074..1743702
Genome map
AA seq 542 aa AA seqDB search
MKPIKEIADQLELKDDILYPYGHYIAKIDHRFLKSLENHEDGKLILVTAVTPTPAGEGKT
TTSIGLSMSLNRIGKKSIVTLREPSLGPTLGLKGGATGGGRSRVLPSDEINLHFTGDMHA
VASAHNLLAAVLDSHIKHGNELKIDITRVFWKRTMDMNDRALRSIVIGLGGSANGFPRED
SFIITAASEVMAILALSENMKDLKERLGKIIVALDADRKIVRISDLGIQGAMAVLLKDAI
NPNLVQTTEGTPALIHCGPFANIAHGTNSIIATKMAMKLSEYTVTEAGFGADLGAEKFID
FVSRVGGFYPNAAVLVATVRALKYHGGANLKNIHEENLEALKEGFKNLRVHVENLRKFNL
PVVVALNRFSTDTEKEIAYVVKECEKLGVRVAVSEVFKKGSEGGVELAKAVAEAAKDVEP
AYLYEMNDPVEKKIEILAKEIYRAGRVEFSDTAKNALKFIKKHGFDELPVIVAKTPKSIS
HDPSLRGAPEGYTFVVSDLFVSAGAGFVVALSGDINLMPGLPKKPNALNMDVDDSGNIVG
VS
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaccgatcaaagagatcgccgatcagttggaattgaaagatgacattctctatcct
tacggccactacatagcgaagatcgaccacagattcttgaaaagccttgaaaatcatgaa
gatgggaaactgatcctcgtaacggcagttacccccacccctgcaggtgaaggaaaaact
accaccagcataggactttccatgtctctgaacagaatcggtaagaaatcgatagttact
ctgagagagccttccctcggccccacccttggattgaaaggcggtgcaacaggaggtggc
aggtcgagggttcttccttctgatgagataaaccttcatttcaccggagatatgcacgcc
gtggcctccgcccacaatctgctggcggccgttctggactcgcacataaaacacggcaac
gagctcaaaatagacataacaagagtattctggaagcgaaccatggacatgaacgaccgt
gctttgagaagcatagtgatcggtcttggaggctcagcgaacggatttccaagagaggac
agtttcatcatcacggccgcttccgaagtgatggccattcttgctctgtccgagaacatg
aaggacctgaaagaaagacttgggaaaataatcgtggcgctcgacgctgacagaaaaatc
gtcaggatctctgatcttggaatccagggtgccatggccgttcttttgaaagatgccata
aatcccaacctcgttcagacaaccgaaggaactccagcgctcatacattgcggacctttc
gccaacatcgcgcacggcaccaattccatcatagcgacgaagatggccatgaagctctcc
gaatacacggtcacggaggcgggttttggagcagacctcggtgctgagaaattcatcgac
tttgtttcccgtgttggtggtttttatccgaacgcagccgttctggtggccacagtgcga
gctttgaagtaccatggtggtgcaaacctcaaaaacatccacgaggaaaacctggaagcc
ctcaaagaaggattcaaaaatctcagggtacacgtggaaaacctgaggaaattcaatctg
cccgtcgtggtagcgctgaacagattcagcacggacacagaaaaggaaatagcctacgtg
gtgaaagagtgcgaaaaactcggtgtgagggtagcagtcagtgaggtttttaaaaagggc
agcgaaggcggtgtcgaactcgcaaaagccgtagcagaagctgcgaaggacgtagaaccg
gcttacctctacgagatgaacgatcctgtggaaaagaagatagagattctcgcaaaagaa
atctacagagcgggaagagtggagttttccgatactgcaaaaaatgccctcaaattcatt
aaaaaacacggttttgatgagcttcccgtgatcgttgccaaaactccaaagtccatttcc
cacgatccgtctctcagaggtgcacctgaaggatacacgttcgttgtcagcgacctcttc
gtttccgccggggcaggctttgttgttgcgctttcaggagacataaatctgatgcctggt
cttccaaaaaaaccaaatgctttgaacatggacgtagacgacagcggtaacatagtaggt
gtttcgtga

DBGET integrated database retrieval system