KEGG   Phaeoacremonium minimum: UCRPA7_1292
Entry
UCRPA7_1292       CDS       T03102                                 

Definition
(RefSeq) putative delta -sterol reductase like protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
tmn  Phaeoacremonium minimum
Pathway
tmn00100  Steroid biosynthesis
tmn01100  Metabolic pathways
tmn01110  Biosynthesis of secondary metabolites
Module
tmn_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:tmn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    UCRPA7_1292
Enzymes [BR:tmn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     UCRPA7_1292
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 19321426
NCBI-ProteinID: XP_007912061
UniProt: R8BV50
Position
Unknown
AA seq 485 aa
MTVKSKKAPVRNAHGYEFCGPPGAFVVSFGLPILLYAFTFACNDISGCPAPSLLSPKTLS
LDALKREAGWPENGIWGFASWSVTGWTIAYYLFSAVLHRVLPGTLVEGTPLSDGGRLKYK
FNTLASTIFTLVICLAGTIAQGAEFPLWTFITDNYLQILTANILISYFLATYVYIRSFSV
KPGNPEHRELAAGGQSGNLLYDWFIGRELNPRVTLPLLGEIDIKEFMEERPGLTGWILMN
LAHCAKQYRTYGTVTDGIVFITVVQALYVIDSQIMEPAILTTIDITTDGFGCMLAFGDVV
WVPFLYSMQTRYLSVHPVSLGPLGVVAMGALLATGFSIFRLANSQKNTFRTNPDDPRVAH
LSYIQTKTGARLITSGWWGVARHINYFGDWLQAWPYSLPTGMAGYQILTAGTGAAGAAVM
ADGREVVPGAARGWGVVFTYFYVLYFAILLIHRDGRDDEKCAKKYGDDWEKYKRVVRYRI
VPGIY
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgacagtcaagtcaaagaaggcgccggtgcggaatgcacatggctatgagttttgcgga
ccgccaggcgcgtttgtcgtctccttcggcctccccatcctcctctacgctttcaccttc
gcttgcaacgacatatctggctgccctgctccatctctgctgtcgcccaagacattgtcg
ctcgatgccctgaagagggaagccgggtggcccgagaatggcatctggggattcgccagc
tggagcgtcaccgggtggacgatagcctactacctgttcagcgccgtcctccaccgtgtt
ttgcccggcaccctcgtggagggcacgccgctctctgatggaggtcgtctgaaatacaag
ttcaacaccctcgcctccaccatcttcaccctcgtcatctgcctcgccggcaccattgcc
cagggcgccgagttccccctgtggaccttcatcaccgacaactacctccagatcctgacc
gcgaacatcctcatctcctacttcctcgcgacctacgtctacatccgctccttcagtgtt
aagcctggcaacccagagcaccgtgagctcgcagccgggggacagagcggcaacctgctg
tacgactggttcatcggccgcgaactcaaccctcgcgtgacgctgccgctgttaggcgag
atcgacatcaaagagttcatggaggagcggccaggactgaccgggtggatcctgatgaac
ctggcgcactgcgccaagcagtaccggacatacgggaccgtgacggacggcatcgtcttc
atcaccgtcgtgcaggcgctgtacgtgatcgacagccagatcatggagccggcgatcctc
acgaccatcgacatcaccaccgacggcttcggctgcatgctcgccttcggcgacgtcgtc
tgggtgcccttcctgtacagcatgcagacgcgctacctgtccgtgcaccccgtgtcgctg
gggcccctcggcgtcgtcgccatgggcgccctgctcgccaccggcttctccatcttccgc
ctcgccaacagccagaagaacaccttccgcaccaacccggacgacccgcgcgtcgcgcat
ctctcgtacatccagaccaagaccggcgcgcgcctcatcacctccggctggtggggcgtc
gcgcgccacatcaactacttcggcgactggctgcaggcgtggccctacagcctgcccacc
ggcatggccggctaccagatcctgaccgccggcaccggcgccgcgggcgccgccgtcatg
gccgacggccgcgaggtcgtgcccggcgcggcccgcggctggggcgtcgtcttcacgtac
ttttacgtgctgtactttgccatcctgctcatccaccgcgacggcagggacgacgagaag
tgcgccaagaagtacggcgacgactgggagaagtacaagagggtcgtcaggtatcgcatc
gtgccgggcatctactag

DBGET integrated database retrieval system