KEGG   Phaeoacremonium minimum: UCRPA7_2423Help
Entry
UCRPA7_2423       CDS       T03102                                 

Definition
(RefSeq) putative dipeptidyl-peptidase 3 protein
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
tmn  Phaeoacremonium minimum
Brite
KEGG Orthology (KO) [BR:tmn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tmn01002]
    UCRPA7_2423
Enzymes [BR:tmn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     UCRPA7_2423
Peptidases and inhibitors [BR:tmn01002]
 Metallo peptidases
  Family M49: dipeptidyl-peptidase III family
   UCRPA7_2423
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 19322671
NCBI-ProteinID: XP_007913215
UniProt: R8BRW9
Position
Unknown
AA seq 703 aa AA seqDB search
MNAQELASYFADAPPSVVRLEIAKHFEALTDKQKRYAHFISQASFAGNRIVLRQVSPEAE
SIYDFIIALHKSSGGDWKALAEKAGVSEADLNSFLEYAAQFLGNSGNYKSFGDSKFIPRA
SEASFAALAATSPEAESHYKATNGAIFSADKPGLLHLGYTDEGHLTTYYPDSPDITKEEI
AAVALWMEKKGLLPENTRLRKTKDGVFELLIASAVTSVPSEGGDIGKDTEYKLDDGKTVR
LVYGDYSKEMAAIARNIKKAAENAENETEEKMHLAYAKSFADGSLLAFKDSQRYWIRDKG
PMVECNIGFIETYRDPAGVRGEWEGFAAVVNQERTRAFGELVRSAPSLIPLLPWNKDFEK
DKFLSPDFTSLEVLTFCGSGIPAGINIPNYDDIRQSDGFKNVSLGNVLSAKAPNEKIPFI
RDEDLEVYQKYRDGSFEVQVGLHELTGHGCGKLLQETSPGEFNFDKENPPVSPLSNEPVK
TWYKPGQTWGSVFGGLAGAYEECRAELVAMYLSCEFPVLKIFGFGDGSVDIDGEAGDVLY
SSYLSMARAGLVSVEYWDPKSQKWGQPHCQARFSILKCFLEAGDDFCKLEYQAEDLSDLK
IKLDRSKILTTGRKAVGEYLQKLHIYKSTADVETGSKFFSHMSGVGLEYWGSKVRNVVLA
NKQPRKVFVQANTYLDEATGEVTCKQYDPSPEGLIQSWVDRES
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctcaagagctggccagctacttcgccgatgccccgccaagtgtcgtgaggctc
gagatcgccaagcactttgaggccctgacagacaagcagaagcgctatgcccacttcata
agccaagcttccttcgcgggaaaccgcattgtcttgagacaggtgtctcctgaagctgag
tccatctatgactttatcattgctttgcacaagagctcgggtggtgactggaaggcgctg
gctgagaaggctggcgtgtcggaggctgatctcaactcatttcttgagtatgctgctcag
tttctcggcaacagcggcaactacaagagctttggtgactccaagtttatcccccgtgcc
tccgaagcctcctttgctgcacttgcagctacctccccggaggctgaaagtcattacaaa
gccacaaatggtgccatcttctcggcagacaagcctggtctgcttcacctcggatacacc
gacgagggtcacctgaccacctattatcctgactccccggacattaccaaggaagagatc
gccgcagtcgcattgtggatggagaagaagggcctactgccagagaacacccgcctccgg
aagactaaggacggggttttcgagcttctgatcgcctctgctgtgacctcagtgcccagc
gaaggtggtgacattggaaaagacactgagtataagctcgacgatggcaagactgtacga
cttgtttacggcgattactctaaggagatggcagcaatcgccagaaatatcaagaaggcc
gcagagaatgcagagaatgagacagaggagaagatgcaccttgcgtacgccaagtcattt
gccgatggatctcttcttgcgttcaaggacagccaaagatattggatcagggacaagggg
ccgatggttgagtgtaacatcggattcatcgaaacctatcgtgacccggcaggtgttcga
ggagaatgggaaggctttgctgcagttgtcaatcaggagagaactcgtgcctttggcgag
ctggttagatctgcaccctcactcatccctctgcttccctggaataaggactttgagaag
gataagttcctctcgcccgatttcacctcccttgaggttcttacattctgtggatccggc
attcccgcaggcatcaacattcccaattacgatgatattcgacaatcagacggtttcaag
aacgtctcattgggcaatgtccttagtgcaaaagctcctaatgagaagattccttttatt
agggacgaggatttggaggtgtatcagaagtatcgtgacggctccttcgaagttcaagtt
ggcctccatgagctcacaggccacggttgcggcaagcttctgcaagaaacatcccctgga
gagtttaacttcgacaaagaaaatccgccggtgagccctctcagcaacgaacccgtcaag
acctggtacaaaccgggccagacctggggttccgtatttggtgggctggctggggcctac
gaagagtgccgtgcagaactcgttgcaatgtatctgagctgcgagttccctgttctcaaa
atctttggcttcggtgacggcagcgttgacatcgatggtgaagcaggtgatgtgctttac
tcttcttatctgagtatggctcgagccggtttggtatcggtagagtactgggaccccaag
tcgcagaaatggggacagccccattgccaggctcgattttcgatcctgaagtgcttcctg
gaagccggtgatgacttctgcaaattggaataccaggctgaagatttgtcggatttgaag
atcaagcttgacaggtccaagatcttaactacaggtcgcaaagctgttggcgagtatctt
cagaagctgcatatctacaagtcgacagcagatgttgagacgggctccaagttctttagt
catatgtcaggcgttggccttgagtactggggctctaaagtcaggaacgtcgtcttagca
aacaaacagccgaggaaggtctttgtgcaggcgaacacctacttagatgaggcaactggg
gaggtgacttgcaagcagtacgatccgtcgccagagggtctgattcaaagctgggttgac
agggagtcgtga

DBGET integrated database retrieval system